| Clone Name | rbart11h11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | O1002_MOUSE (Q8VFK2) Olfactory receptor 1002 (Olfactory receptor... | 30 | 2.9 | 2 | SPA4L_MOUSE (Q9DA32) Sperm-associated antigen 4-like protein | 29 | 5.0 |
|---|
>O1002_MOUSE (Q8VFK2) Olfactory receptor 1002 (Olfactory receptor 175-2)| Length = 318 Score = 30.0 bits (66), Expect = 2.9 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 13/77 (16%) Frame = -3 Query: 232 RYLSIIKPILY-----MRACVVHVVRAR-----TTLLRDESIMYE*YCMVQLLNLF---L 92 RY++I KP+LY R CV V+ +T++ S YC L+N F L Sbjct: 122 RYVAICKPLLYTLIMSQRVCVQLVIGPYSIGLISTVVHTTSAFILPYCGPNLINHFFCDL 181 Query: 91 LCIFMMYMHDMHMNKYV 41 L + + D MNK++ Sbjct: 182 LPVLSLACADTQMNKHL 198
>SPA4L_MOUSE (Q9DA32) Sperm-associated antigen 4-like protein| Length = 348 Score = 29.3 bits (64), Expect = 5.0 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -3 Query: 118 MVQLLNLFLLCIFMMYMHDMHMNKYVSVW 32 +++ + L +LC+F +M MH+ V VW Sbjct: 74 VMEKMGLLVLCVFGFWMFSMHLPSKVEVW 102 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,855,231 Number of Sequences: 219361 Number of extensions: 916969 Number of successful extensions: 1987 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1950 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1987 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)