>AL2SA_HUMAN (Q53TS8) Amyotrophic lateral sclerosis 2 chromosomal region|
           candidate gene 11 protein
          Length = 623

 Score = 29.3 bits (64), Expect = 6.6
 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = -3

Query: 153 KEKEKFRVG*VKLML-RFTRKLCFVCVYLLIVGGLFVPRLIVKYIYKY 13
           +EK  F +G V++ L    +K CF+    ++ G +FV RL V++++ Y
Sbjct: 194 REKRAFLLGSVQIHLYEVIQKGCFIEEVQVLHGNIFVCRLEVEFMFSY 241


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 51,630,210
Number of Sequences: 219361
Number of extensions: 739241
Number of successful extensions: 1574
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1556
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1574
length of database: 80,573,946
effective HSP length: 104
effective length of database: 57,760,402
effective search space used: 3812186532
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)