Clone Name | rbart11g07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ICAM1_RAT (Q00238) Intercellular adhesion molecule 1 precursor (... | 29 | 3.8 | 2 | CLFA_STAAR (Q6GIK4) Clumping factor A precursor (Fibrinogen-bind... | 29 | 3.8 | 3 | UNG_SCHPO (O74834) Uracil-DNA glycosylase (EC 3.2.2.-) (UDG) | 28 | 4.9 | 4 | NU4M_DINSE (O79555) NADH-ubiquinone oxidoreductase chain 4 (EC 1... | 28 | 8.4 |
---|
>ICAM1_RAT (Q00238) Intercellular adhesion molecule 1 precursor (ICAM-1)| Length = 545 Score = 28.9 bits (63), Expect = 3.8 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 3/62 (4%) Frame = +2 Query: 44 PPKWEPLSSTNHQDTSNKRVFLVAI---IPYKNLFSEEGVHSSLLWGKPHSPGSSCFGSF 214 PP + + N +KR F + + K+LF + + +L+G PH C G++ Sbjct: 360 PPTSQIQFTLNASPEDHKRRFFCSAALEVDGKSLFKNQTLELHVLYG-PHLDKKDCLGNW 418 Query: 215 TW 220 TW Sbjct: 419 TW 420
>CLFA_STAAR (Q6GIK4) Clumping factor A precursor (Fibrinogen-binding protein A)| (Fibrinogen receptor A) Length = 1029 Score = 28.9 bits (63), Expect = 3.8 Identities = 20/57 (35%), Positives = 29/57 (50%) Frame = +2 Query: 26 SSKYIIPPKWEPLSSTNHQDTSNKRVFLVAIIPYKNLFSEEGVHSSLLWGKPHSPGS 196 S+ ++PP P S TN SNK + P + SE+ ++SL+WG S GS Sbjct: 963 SNNNVVPPN-SPKSGTN---ASNKNEAKESKEPLPDTGSEDEANTSLIWGLLASLGS 1015
>UNG_SCHPO (O74834) Uracil-DNA glycosylase (EC 3.2.2.-) (UDG)| Length = 322 Score = 28.5 bits (62), Expect = 4.9 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +2 Query: 29 SKYIIPPKWEPLSSTNHQDTSNKRVFLVAIIPYKNLFSEEGVHSSLLWGKPHSP 190 S+ + PPK + S ++H +V L+ PY N+ G+ S+ G P P Sbjct: 112 SQRVFPPKEDIYSWSHHTPLHKTKVILLGQDPYHNIGQAHGLCFSVRPGIPCPP 165
>NU4M_DINSE (O79555) NADH-ubiquinone oxidoreductase chain 4 (EC 1.6.5.3) (NADH| dehydrogenase subunit 4) Length = 445 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = +1 Query: 154 TLFSSLGQTTLPWI-FMLWLIYLG 222 TLF + QTT PW MLW+ LG Sbjct: 169 TLFMQMMQTTSPWTELMLWIACLG 192 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,758,988 Number of Sequences: 219361 Number of extensions: 679152 Number of successful extensions: 1910 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1891 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1910 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)