ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart11g05 |
|---|---|
| Clone Library Name | barley_pub |
>INO1_ORYSA (O64437) Inositol-3-phosphate synthase (EC 5.5.1.4)| (Myo-inositol-1-phosphate synthase) (MI-1-P synthase) (IPS) Length = 510 Score = 74.7 bits (182), Expect = 1e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 468 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 361 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK Sbjct: 475 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510
>INO1_MAIZE (Q9FPK7) Inositol-3-phosphate synthase (EC 5.5.1.4)| (Myo-inositol-1-phosphate synthase) (MI-1-P synthase) (IPS) Length = 510 Score = 74.7 bits (182), Expect = 1e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 468 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 361 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK Sbjct: 475 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510
>INO1_HORVU (O65195) Inositol-3-phosphate synthase (EC 5.5.1.4)| (Myo-inositol-1-phosphate synthase) (MI-1-P synthase) (IPS) Length = 510 Score = 74.7 bits (182), Expect = 1e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -1 Query: 468 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 361 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK Sbjct: 475 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510
>INO1_CITPA (P42802) Inositol-3-phosphate synthase (EC 5.5.1.4)| (Myo-inositol-1-phosphate synthase) (MI-1-P synthase) (IPS) Length = 507 Score = 72.4 bits (176), Expect = 5e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -1 Query: 468 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 361 GTPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK Sbjct: 472 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 507
>INO1_MESCR (Q40271) Inositol-3-phosphate synthase (EC 5.5.1.4)| (Myo-inositol-1-phosphate synthase) (MI-1-P synthase) (IPS) Length = 512 Score = 72.4 bits (176), Expect = 5e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -1 Query: 468 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 361 GTPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK Sbjct: 477 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 512
>INO1_WHEAT (Q9S7U0) Inositol-3-phosphate synthase (EC 5.5.1.4)| (Myo-inositol-1-phosphate synthase) (MI-1-P synthase) (IPS) Length = 510 Score = 72.4 bits (176), Expect = 5e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -1 Query: 468 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 361 GTPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK Sbjct: 475 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
>INO1_TOBAC (Q9LW96) Inositol-3-phosphate synthase (EC 5.5.1.4)| (Myo-inositol-1-phosphate synthase) (MI-1-P synthase) (IPS) Length = 510 Score = 72.4 bits (176), Expect = 5e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -1 Query: 468 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 361 GTPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK Sbjct: 475 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
>INO1_SPIPO (P42803) Inositol-3-phosphate synthase (EC 5.5.1.4)| (Myo-inositol-1-phosphate synthase) (MI-1-P synthase) (IPS) Length = 510 Score = 72.4 bits (176), Expect = 5e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -1 Query: 468 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 361 GTPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK Sbjct: 475 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
>INO1_SESIN (Q9FYV1) Inositol-3-phosphate synthase (EC 5.5.1.4)| (Myo-inositol-1-phosphate synthase) (MI-1-P synthase) (IPS) Length = 510 Score = 72.4 bits (176), Expect = 5e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -1 Query: 468 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 361 GTPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK Sbjct: 475 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
>INO1_NICPA (Q9SSV4) Inositol-3-phosphate synthase (EC 5.5.1.4)| (Myo-inositol-1-phosphate synthase) (MI-1-P synthase) (IPS) Length = 510 Score = 72.4 bits (176), Expect = 5e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -1 Query: 468 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 361 GTPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK Sbjct: 475 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
>INO1_BRANA (Q96348) Inositol-3-phosphate synthase (EC 5.5.1.4)| (Myo-inositol-1-phosphate synthase) (MI-1-P synthase) (IPS) Length = 510 Score = 72.4 bits (176), Expect = 5e-13 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -1 Query: 468 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 361 GTPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK Sbjct: 475 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
>INO3_ARATH (Q9LX12) Probable inositol-3-phosphate synthase isozyme 3 (EC| 5.5.1.4) (Myo-inositol-1-phosphate synthase 3) (MI-1-P synthase 3) (IPS 3) Length = 510 Score = 72.0 bits (175), Expect = 7e-13 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -1 Query: 468 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 361 GTPVVNAL+KQRAMLEN++RACVGLAPENNMILEYK Sbjct: 475 GTPVVNALSKQRAMLENVLRACVGLAPENNMILEYK 510
>INO2_ARATH (Q38862) Inositol-3-phosphate synthase isozyme 2 (EC 5.5.1.4)| (Myo-inositol-1-phosphate synthase 2) (MI-1-P synthase 2) (IPS 2) Length = 510 Score = 71.6 bits (174), Expect = 9e-13 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -1 Query: 468 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 361 GTPVVNAL+KQRAMLENI+RACVGLAPENNMI+EYK Sbjct: 475 GTPVVNALSKQRAMLENILRACVGLAPENNMIMEYK 510
>INO1_PHAVU (Q41107) Inositol-3-phosphate synthase (EC 5.5.1.4)| (Myo-inositol-1-phosphate synthase) (MI-1-P synthase) (IPS) Length = 511 Score = 70.9 bits (172), Expect = 2e-12 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -1 Query: 468 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 361 GTPV+NAL+KQRAMLENIMRACVGLAPENNMI+E+K Sbjct: 476 GTPVINALSKQRAMLENIMRACVGLAPENNMIMEFK 511
>INO1_ARATH (P42801) Inositol-3-phosphate synthase isozyme 1 (EC 5.5.1.4)| (Myo-inositol-1-phosphate synthase 1) (MI-1-P synthase 1) (IPS 1) Length = 511 Score = 70.9 bits (172), Expect = 2e-12 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -1 Query: 468 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 361 GTPV+NAL+KQRAMLENIMRACVGLAPENNMI+E+K Sbjct: 476 GTPVINALSKQRAMLENIMRACVGLAPENNMIMEFK 511
>INO1_DROME (O97477) Inositol-3-phosphate synthase (EC 5.5.1.4)| (Myo-inositol-1-phosphate synthase) (MI-1-P synthase) (IPS) Length = 565 Score = 44.3 bits (103), Expect = 2e-04 Identities = 19/36 (52%), Positives = 28/36 (77%) Frame = -1 Query: 468 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 361 G+ VVN+L +QRA +ENI+R C+GL P ++M LE + Sbjct: 478 GSQVVNSLFRQRAAIENILRGCIGLPPISHMTLEQR 513
>INO1_YEAST (P11986) Inositol-3-phosphate synthase (EC 5.5.1.4)| (Myo-inositol-1-phosphate synthase) (MI-1-P synthase) (IPS) Length = 533 Score = 31.2 bits (69), Expect = 1.4 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 456 VNALAKQRAMLENIMRACVGLAPENNMILE 367 VN L KQR LEN +R +GL +N + E Sbjct: 500 VNGLNKQRTALENFLRLLIGLPSQNELRFE 529
>CD014_HUMAN (Q8NC60) Protein C4orf14| Length = 698 Score = 30.4 bits (67), Expect = 2.3 Identities = 22/73 (30%), Positives = 30/73 (41%), Gaps = 22/73 (30%) Frame = +1 Query: 316 YVRNVTVGLRRPCSSLVL----------------------QDHVVLGRQADARPHDVLQH 429 Y+ V+ LRRP SLVL + +VLG + D P D + Sbjct: 201 YLELVSAALRRPGPSLVLYMVDLLDLPDALLPDLPALVGPKQLIVLGNKVDLLPQDAPGY 260 Query: 430 RPLLRQRVHHRCA 468 R LR+R+ CA Sbjct: 261 RQRLRERLWEDCA 273
>NAS32_CAEEL (O16977) Zinc metalloproteinase nas-32 precursor (EC 3.4.24.21)| (Nematode astacin 32) Length = 651 Score = 28.9 bits (63), Expect = 6.8 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = -3 Query: 184 CCVCVCPCETGSALCP-----GSATTVWCWVMWREE 92 C VC+CP G ALC G +T+ W++E Sbjct: 412 CSVCICPYGFGGALCTERTDYGCGSTLTATDTWQQE 447 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,094,710 Number of Sequences: 219361 Number of extensions: 747367 Number of successful extensions: 2288 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 2225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2281 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
