| Clone Name | rbart11f11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TA2R8_PAPHA (Q646G4) Taste receptor type 2 member 8 (T2R8) | 32 | 0.71 | 2 | COX3_LEITA (P14546) Cytochrome c oxidase subunit 3 (EC 1.9.3.1) ... | 29 | 6.0 | 3 | TR150_HUMAN (Q9Y2W1) Thyroid hormone receptor-associated protein... | 29 | 7.8 | 4 | TIP60_DROME (Q960X4) Histone acetyltransferase Tip60 (EC 2.3.1.48) | 29 | 7.8 | 5 | SPP2_NEUCR (Q7SBU7) Pre-mRNA-splicing factor spp-2 | 29 | 7.8 |
|---|
>TA2R8_PAPHA (Q646G4) Taste receptor type 2 member 8 (T2R8)| Length = 309 Score = 32.3 bits (72), Expect = 0.71 Identities = 18/66 (27%), Positives = 37/66 (56%), Gaps = 7/66 (10%) Frame = -1 Query: 208 LSAFDCRVCALLFARICLVSACVVD-VRVIMYCCLYAFVEI*RVL------LNFLQIFFS 50 +S DC + L+ +RICL+S VV+ + +++Y +Y ++ V+ N+L ++F+ Sbjct: 41 ISTIDCILTNLVISRICLISVMVVNGIVIVLYPDVYTKTKLQIVICTFWTFANYLNMWFT 100 Query: 49 TSCTVY 32 V+ Sbjct: 101 ACLNVF 106
>COX3_LEITA (P14546) Cytochrome c oxidase subunit 3 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide III) Length = 284 Score = 29.3 bits (64), Expect = 6.0 Identities = 22/77 (28%), Positives = 30/77 (38%), Gaps = 11/77 (14%) Frame = -1 Query: 199 FDCRVCALLFARICLVSACVVD-----------VRVIMYCCLYAFVEI*RVLLNFLQIFF 53 F C LLF +CL+ VD +R I YC ++ + LL FL +F+ Sbjct: 46 FICFFACLLFCLVCLLCDLFVDSLRGLFDVCCFIRCIQYCFVWFIIS---ELLLFLSLFY 102 Query: 52 STSCTVYLCYSELGTVF 2 V E VF Sbjct: 103 VVFSLVLFVSVEFAFVF 119
>TR150_HUMAN (Q9Y2W1) Thyroid hormone receptor-associated protein 3 (Thyroid| hormone receptor-associated protein complex 150 kDa component) (Trap150) Length = 955 Score = 28.9 bits (63), Expect = 7.8 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 148 HSLNRSAQKAEHTHGNQKQRATDTRTRRQSADHS 249 HS RSA+K E TH K++ R R +S S Sbjct: 748 HSRERSAEKTEKTHKGSKKQKKHRRARDRSRSSS 781
>TIP60_DROME (Q960X4) Histone acetyltransferase Tip60 (EC 2.3.1.48)| Length = 541 Score = 28.9 bits (63), Expect = 7.8 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = +1 Query: 97 QKRIDNNT*SHGHPLHKHSLNRSAQKAEHTHGNQKQRATDT 219 QKRI+ +HG H H S Q+ H H Q T T Sbjct: 171 QKRINRKRKNHGGSAHGHHSLTSQQQQSHPHPTTPQTPTAT 211
>SPP2_NEUCR (Q7SBU7) Pre-mRNA-splicing factor spp-2| Length = 358 Score = 28.9 bits (63), Expect = 7.8 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Frame = +1 Query: 157 NRSAQKAEHTHGNQKQRATD--TRTRRQSADHSXXXXXXXXXPWCCDE-ETAPPRW 315 NRS + H + + + D +R+RR+S S P E ETAPP+W Sbjct: 114 NRSQDRDRHNNRSSRPSRDDDASRSRRRSTSRSRDRDHKPKDPKDLQEPETAPPKW 169 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,776,709 Number of Sequences: 219361 Number of extensions: 971906 Number of successful extensions: 2997 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2898 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2990 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)