Clone Name | rbart11f10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RSBQ_BACSU (O07015) Sigma factor sigB regulation protein rsbQ | 40 | 0.004 | 2 | LONH1_THEAC (Q9HJ89) Putative protease La homolog type 1 (EC 3.4... | 30 | 3.5 | 3 | LONH1_THEVO (P58274) Putative protease La homolog type 1 (EC 3.4... | 30 | 3.5 | 4 | VINT_BPMFR (P25426) Integrase | 29 | 7.8 | 5 | LONH_ARCFU (O29883) Putative protease La homolog type (EC 3.4.21.-) | 29 | 7.8 |
---|
>RSBQ_BACSU (O07015) Sigma factor sigB regulation protein rsbQ| Length = 269 Score = 39.7 bits (91), Expect = 0.004 Identities = 19/57 (33%), Positives = 31/57 (54%) Frame = -3 Query: 489 DLRGVLGMVQAPCVVVQTTRDVSVPASVAAYLKAHLGGRTTIEPLPTEGHLPHLSAP 319 D R L V P +++Q D+ PA+V Y+ HL ++++ + GH PH+S P Sbjct: 199 DHREDLSKVTVPSLILQCADDIIAPATVGKYMHQHLP-YSSLKQMEARGHCPHMSHP 254
>LONH1_THEAC (Q9HJ89) Putative protease La homolog type 1 (EC 3.4.21.-)| Length = 657 Score = 30.0 bits (66), Expect = 3.5 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 257 KKERGKKLLHLDLHVEYVGGTRGREGHAKS 168 KK GK + ++D+H+++VG G EG + S Sbjct: 498 KKLTGKDISNMDIHIQFVGTYEGVEGDSAS 527
>LONH1_THEVO (P58274) Putative protease La homolog type 1 (EC 3.4.21.-)| Length = 655 Score = 30.0 bits (66), Expect = 3.5 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 257 KKERGKKLLHLDLHVEYVGGTRGREGHAKS 168 KK GK + ++D+H+++VG G EG + S Sbjct: 498 KKITGKDISNMDIHIQFVGTYEGVEGDSAS 527
>VINT_BPMFR (P25426) Integrase| Length = 333 Score = 28.9 bits (63), Expect = 7.8 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 444 VQTTRDVSVPASVAAYLKAHLGGRTTIEPLP 352 V++ R V+VP VAA ++AH+ RT + P Sbjct: 208 VRSKRPVTVPPHVAAMIRAHMADRTKMNKGP 238
>LONH_ARCFU (O29883) Putative protease La homolog type (EC 3.4.21.-)| Length = 621 Score = 28.9 bits (63), Expect = 7.8 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = -1 Query: 257 KKERGKKLLHLDLHVEYVGGTRGREGHAKS 168 KK G+ + ++D+H+++VG G EG + S Sbjct: 482 KKYTGRDISNMDVHIQFVGTYEGVEGDSAS 511 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,402,603 Number of Sequences: 219361 Number of extensions: 900193 Number of successful extensions: 2747 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2747 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)