Clone Name | rbart11e10 |
---|---|
Clone Library Name | barley_pub |
>TTC1_MOUSE (Q91Z38) Tetratricopeptide repeat protein 1 (TPR repeat protein 1)| Length = 292 Score = 34.3 bits (77), Expect = 0.19 Identities = 14/27 (51%), Positives = 21/27 (77%) Frame = -3 Query: 496 VLGRFGMSVDNFKAVKDPNTGSYSVSF 416 VL FG+S +NF+ +D +TGSYS++F Sbjct: 258 VLRPFGLSTENFQIKQDSSTGSYSINF 284
>TTC1_HUMAN (Q99614) Tetratricopeptide repeat protein 1 (TPR repeat protein 1)| Length = 292 Score = 34.3 bits (77), Expect = 0.19 Identities = 14/27 (51%), Positives = 21/27 (77%) Frame = -3 Query: 496 VLGRFGMSVDNFKAVKDPNTGSYSVSF 416 VL FG+S +NF+ +D +TGSYS++F Sbjct: 258 VLRPFGLSTENFQIKQDSSTGSYSINF 284
>MVIN_RHITR (O05467) Virulence factor mviN homolog| Length = 533 Score = 33.9 bits (76), Expect = 0.25 Identities = 17/39 (43%), Positives = 26/39 (66%), Gaps = 3/39 (7%) Frame = -3 Query: 184 AAQAP---SLFL*TALHFSLFFNMDPLSVAQLLSWQILV 77 AA AP +L + +AL ++++F DPL+ A LSW +LV Sbjct: 161 AAVAPIFLNLVMISALFYAIYFGADPLTTAWYLSWSVLV 199
>L_MABVP (P35262) Large structural protein (L protein) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2331 Score = 30.0 bits (66), Expect = 3.6 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -1 Query: 213 AFMYDARVHLLPRHQVCFCKRLFIFPYFLTWIHYLLPNCF 94 AF Y+ RH + +C R + W+H+L+P C+ Sbjct: 642 AFRYE-----FTRHFIDYCNRCYGVKNLFDWMHFLIPLCY 676
>L_MABVM (P31352) Large structural protein (L protein) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2331 Score = 30.0 bits (66), Expect = 3.6 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -1 Query: 213 AFMYDARVHLLPRHQVCFCKRLFIFPYFLTWIHYLLPNCF 94 AF Y+ RH + +C R + W+H+L+P C+ Sbjct: 642 AFRYE-----FTRHFIDYCNRCYGVKNLFDWMHFLIPLCY 676
>1A43_HUMAN (P30456) HLA class I histocompatibility antigen, A-43 alpha chain| precursor (MHC class I antigen A*43) (Aw-43) Length = 365 Score = 28.9 bits (63), Expect = 7.9 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +3 Query: 225 IKSKNDQAHLQIERSNCKSARPLHNLSRTIATMIERMY 338 ++++N +AH Q +R+N + R +N S + I+RMY Sbjct: 86 LQTRNVKAHSQTDRANLGTLRGYYNQSEDGSHTIQRMY 123 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,694,131 Number of Sequences: 219361 Number of extensions: 1560909 Number of successful extensions: 3510 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3395 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3510 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)