Clone Name | rbart11d02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MEGF8_MOUSE (P60882) Multiple epidermal growth factor-like domai... | 29 | 5.6 | 2 | MEGF8_HUMAN (Q7Z7M0) Multiple epidermal growth factor-like domai... | 28 | 9.6 | 3 | MEMB_METTR (P27354) Methane monooxygenase component A beta chain... | 28 | 9.6 |
---|
>MEGF8_MOUSE (P60882) Multiple epidermal growth factor-like domains 8 (EGF-like| domain-containing protein 4) (Multiple EGF-like domain protein 4) Length = 2330 Score = 29.3 bits (64), Expect = 5.6 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 296 WCQGRCRSTASLGAATGRRP*ASC 225 WCQG C++ G +G P ASC Sbjct: 120 WCQGACQAAPPPGTPSGACPAASC 143
>MEGF8_HUMAN (Q7Z7M0) Multiple epidermal growth factor-like domains 8 (EGF-like| domain-containing protein 4) (Multiple EGF-like domain protein 4) Length = 2386 Score = 28.5 bits (62), Expect = 9.6 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 296 WCQGRCRSTASLGAATGRRP*ASC 225 WCQG C++ G G P ASC Sbjct: 120 WCQGACQAAPPPGTPLGACPAASC 143
>MEMB_METTR (P27354) Methane monooxygenase component A beta chain (EC| 1.14.13.25) (Methane hydroxylase) Length = 393 Score = 28.5 bits (62), Expect = 9.6 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 235 HGRRPVAAPKEAVDLHRPWHQHRHPASSGHHP 330 HG RP + W++HR PA HHP Sbjct: 79 HGGRPSWGNESTELRTTDWYRHRDPARRWHHP 110 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,037,585 Number of Sequences: 219361 Number of extensions: 665867 Number of successful extensions: 1603 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1597 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)