| Clone Name | rbart11c05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CRDL2_HUMAN (Q6WN34) Chordin-like protein 2 precursor (Chordin-r... | 31 | 2.1 | 2 | CAP_YEAST (P17555) Adenylyl cyclase-associated protein (CAP) | 30 | 3.5 | 3 | SUWA_DROME (P12297) Protein suppressor of white apricot | 29 | 7.8 | 4 | VPG_PLRVW (P11625) Putative genome-linked protein precursor (VPG... | 29 | 7.8 |
|---|
>CRDL2_HUMAN (Q6WN34) Chordin-like protein 2 precursor (Chordin-related protein| 2) (Breast tumor novel factor 1) (BNF-1) Length = 429 Score = 30.8 bits (68), Expect = 2.1 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +3 Query: 147 QVAASSSTGRKTGP-PPTPHDLTLSPISSFSRLY*PKSSARRTKKYLARKKY 299 Q SS GRK GP P P L+ +P+S R + PK + T K + ++K+ Sbjct: 198 QDPCSSDAGRKRGPGTPAPTGLS-APLSFIPRHFRPKGAGSTTVKIVLKEKH 248
>CAP_YEAST (P17555) Adenylyl cyclase-associated protein (CAP)| Length = 526 Score = 30.0 bits (66), Expect = 3.5 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = +3 Query: 111 TERTHTYTRIQQQVAASSSTGRKTGPPPTPHDLTLSPISSFSRLY*PKSSARRTKKYLAR 290 +++TH ++Q + SSTG K+GPPP P K S +TK+ + Sbjct: 330 SQQTHKNPELRQS-STVSSTGSKSGPPPRP----------------KKPSTLKTKRPPRK 372 Query: 291 KKYGSRFF 314 + G+++F Sbjct: 373 ELVGNKWF 380
>SUWA_DROME (P12297) Protein suppressor of white apricot| Length = 963 Score = 28.9 bits (63), Expect = 7.8 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 397 TRQPCARNHRRPPDHRRLRTPGSRFHPRHLRRQ 495 +R P RN + R RTP + H RH RR+ Sbjct: 926 SRSPSCRNAEQRRQQDRRRTPTKKSHKRHKRRR 958
>VPG_PLRVW (P11625) Putative genome-linked protein precursor (VPG) (17 kDa| protein) (ORF 5) Length = 156 Score = 28.9 bits (63), Expect = 7.8 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +3 Query: 138 IQQQVAASSSTGRKTGPPPTPHDLTLSPISSFSRLY*PKSSARRTKKYL 284 I+ Q + SS+ R PPP P ++ +PI+ Y P S + K+L Sbjct: 102 IRSQASYFSSSARPLPPPPVPSLMSWTPIAK----YHPSSPTSTSSKFL 146 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,652,882 Number of Sequences: 219361 Number of extensions: 1046069 Number of successful extensions: 2542 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2538 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)