Clone Name | rbart11b02 |
---|---|
Clone Library Name | barley_pub |
>IPYR_ORYSA (O22537) Soluble inorganic pyrophosphatase (EC 3.6.1.1)| (Pyrophosphate phospho-hydrolase) (PPase) Length = 214 Score = 65.1 bits (157), Expect = 6e-11 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -2 Query: 415 YKKNENKEVAVNDFLPSEDAYEAIQHSMDLYATYICEVLRR 293 YKKNENKEVAVN+FLP+EDA AI++SMDLY YI E LR+ Sbjct: 174 YKKNENKEVAVNEFLPAEDAINAIKYSMDLYGAYIIESLRK 214
>IPYR_SOLTU (Q43187) Soluble inorganic pyrophosphatase (EC 3.6.1.1)| (Pyrophosphate phospho-hydrolase) (PPase) Length = 211 Score = 59.3 bits (142), Expect = 3e-09 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 415 YKKNENKEVAVNDFLPSEDAYEAIQHSMDLYATYICEVLRR 293 YKKNENK+VAV+DFLP A AIQ+SMDLYA YI LR+ Sbjct: 171 YKKNENKDVAVDDFLPPNSAVNAIQYSMDLYAEYILHSLRK 211
>IPYR_MAIZE (O48556) Soluble inorganic pyrophosphatase (EC 3.6.1.1)| (Pyrophosphate phospho-hydrolase) (PPase) Length = 214 Score = 59.3 bits (142), Expect = 3e-09 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -2 Query: 415 YKKNENKEVAVNDFLPSEDAYEAIQHSMDLYATYICEVLRR 293 YKKNENKEVAV+ FLP+ A EAIQ+SMDLYA YI + LR+ Sbjct: 174 YKKNENKEVAVDAFLPATTAREAIQYSMDLYAQYILQSLRQ 214
>IPYR_HORVD (O23979) Soluble inorganic pyrophosphatase (EC 3.6.1.1)| (Pyrophosphate phospho-hydrolase) (PPase) Length = 215 Score = 59.3 bits (142), Expect = 3e-09 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -2 Query: 415 YKKNENKEVAVNDFLPSEDAYEAIQHSMDLYATYICEVLRR 293 YKKNENKEVAV+ FLP+ A EAIQ+SMDLYA YI + LR+ Sbjct: 175 YKKNENKEVAVDAFLPATTAREAIQYSMDLYAQYILQSLRQ 215
>IPYR_ARATH (P21216) Soluble inorganic pyrophosphatase (EC 3.6.1.1)| (Pyrophosphate phospho-hydrolase) (PPase) Length = 218 Score = 50.4 bits (119), Expect = 2e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -2 Query: 415 YKKNENKEVAVNDFLPSEDAYEAIQHSMDLYATYICEVLRR 293 YKKNENK+V V FLP++ A +AI+ SMDLYA YI L+R Sbjct: 178 YKKNENKKVDVEAFLPAQAAIDAIKDSMDLYAAYIKAGLQR 218
>IPYR_METTH (O26363) Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate| phospho-hydrolase) (PPase) Length = 176 Score = 30.0 bits (66), Expect = 2.3 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -2 Query: 415 YKKNENKEVAVNDFLPSEDAYEAIQHSMDLY 323 YKK E K+ + +E A+EA+ HS++LY Sbjct: 140 YKKLEGKKTETLGWEGAEKAFEAVNHSIELY 170
>RADC_XYLFT (Q87F21) DNA repair protein radC homolog| Length = 224 Score = 28.9 bits (63), Expect = 5.0 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -1 Query: 368 IGGRIRGHPALHGSLCHLHLRGP--EKVDNRSGDAMPLAG 255 +G +RGH A+ + LH GP E +D GD M L G Sbjct: 34 LGSGLRGHDAVQTARNLLHTHGPLRELLDRPPGDLMRLPG 73
>RADC_XYLFA (Q9PGZ8) DNA repair protein radC homolog| Length = 224 Score = 28.9 bits (63), Expect = 5.0 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -1 Query: 368 IGGRIRGHPALHGSLCHLHLRGP--EKVDNRSGDAMPLAG 255 +G +RGH A+ + LH GP E +D GD M L G Sbjct: 34 LGSGLRGHDAVQTARNLLHTHGPLRELLDRPPGDLMRLPG 73 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,580,233 Number of Sequences: 219361 Number of extensions: 1071532 Number of successful extensions: 2262 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2232 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2262 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)