Clone Name | rbart11a03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ICAM2_HUMAN (P13598) Intercellular adhesion molecule 2 precursor... | 29 | 5.2 | 2 | FTHS_ENTFA (Q834D6) Formate--tetrahydrofolate ligase (EC 6.3.4.3... | 28 | 8.9 |
---|
>ICAM2_HUMAN (P13598) Intercellular adhesion molecule 2 precursor (ICAM-2)| (CD102 antigen) Length = 275 Score = 29.3 bits (64), Expect = 5.2 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 4/58 (6%) Frame = -2 Query: 266 STTCLTGS-GKRSEFLSVLLVSQEAAWKRYCP---SYDAIFVCK*YCQRKTEFISSSL 105 STTC G L+ +L+ ++A WK Y S+D + C C K E ++S++ Sbjct: 49 STTCNQPEVGGLETSLNKILLDEQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSNV 106
>FTHS_ENTFA (Q834D6) Formate--tetrahydrofolate ligase (EC 6.3.4.3)| (Formyltetrahydrofolate synthetase) (FHS) (FTHFS) Length = 556 Score = 28.5 bits (62), Expect = 8.9 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -1 Query: 405 EKLVQKQQYFQNLSKHIHLKGRYDAVISVAI 313 E L Q+ F NL KHI RYD + VAI Sbjct: 348 ENLPALQKGFANLEKHIQNMQRYDVPVVVAI 378 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,142,553 Number of Sequences: 219361 Number of extensions: 1358520 Number of successful extensions: 3333 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3263 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3333 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)