Clone Name | rbart11a01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | STA5A_SHEEP (P42231) Signal transducer and activator of transcri... | 30 | 4.7 | 2 | CBIO1_MYCMS (Q6MSQ2) Cobalt import ATP-binding protein cbiO 1 | 29 | 6.2 | 3 | CCPR_YARLI (Q6C0Z6) Cytochrome c peroxidase, mitochondrial precu... | 29 | 8.1 |
---|
>STA5A_SHEEP (P42231) Signal transducer and activator of transcription 5A| (Mammary gland factor) Length = 794 Score = 29.6 bits (65), Expect = 4.7 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 144 RTVQLIHTNQT*ILCSPPISWNQSHTWSLLEQTRRS 251 +T+QL+ QT IL I W + H W +E RS Sbjct: 236 KTLQLLRKQQTIILDDELIQWKRRHDWRGMEAPPRS 271
>CBIO1_MYCMS (Q6MSQ2) Cobalt import ATP-binding protein cbiO 1| Length = 303 Score = 29.3 bits (64), Expect = 6.2 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -3 Query: 240 FVPRETTCVIGSTRSGVST--EFTSGLCVS 157 F + TCVIG+T SG ST + T+GL +S Sbjct: 48 FKKNKVTCVIGTTGSGKSTMIQLTNGLIIS 77
>CCPR_YARLI (Q6C0Z6) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 340 Score = 28.9 bits (63), Expect = 8.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 Query: 194 PDLVEPITHVVSLGTNQTFNNQQHVALYGTRLL 292 PD + THV ++ Q FN+Q+ VAL G L Sbjct: 194 PDASQGATHVRNVFNRQGFNDQEMVALIGAHAL 226 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,773,396 Number of Sequences: 219361 Number of extensions: 960788 Number of successful extensions: 2412 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2412 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)