Clone Name | rbart10h03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SSY1_ORYSA (Q40739) Soluble starch synthase 1, chloroplast precu... | 28 | 8.6 |
---|
>SSY1_ORYSA (Q40739) Soluble starch synthase 1, chloroplast precursor (EC| 2.4.1.21) (Starch synthase I) (SSS 1) Length = 626 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 88 DGGLREIIFSRANMYTNKHKGWIQG*LPASHTLTSG 195 D G + S + Y +K +GW+ +P SH +T+G Sbjct: 487 DPGFEGWMRSTESGYRDKFRGWVGFSVPVSHRITAG 522 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,816,510 Number of Sequences: 219361 Number of extensions: 514034 Number of successful extensions: 954 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 944 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 952 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)