Clone Name | rbart10d02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ATP7A_HUMAN (Q04656) Copper-transporting ATPase 1 (EC 3.6.3.4) (... | 28 | 7.7 |
---|
>ATP7A_HUMAN (Q04656) Copper-transporting ATPase 1 (EC 3.6.3.4) (Copper pump 1)| (Menkes disease-associated protein) Length = 1500 Score = 28.5 bits (62), Expect = 7.7 Identities = 21/93 (22%), Positives = 41/93 (44%), Gaps = 2/93 (2%) Frame = +2 Query: 14 GFGSFSKKEPPYNTTVAFIIEQFSSL*EKPPRGKNRY*C*YTNLPSTSILSYGFSCR--L 187 GF +F KK+P Y A +E+ + K G + YTN + + + G C+ + Sbjct: 233 GFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYTNDSTATFIIDGMHCKSCV 292 Query: 188 NALFAVLGTSSKFSAPLLSCHGEAFVPRSGAES 286 + + + L S+ ++S + + + A S Sbjct: 293 SNIESTLSALQYVSSIVVSLENRSAIVKYNASS 325 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,751,344 Number of Sequences: 219361 Number of extensions: 1086513 Number of successful extensions: 2848 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2811 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2848 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)