Clone Name | rbart10c12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DTD_LACAC (Q5FKI6) D-tyrosyl-tRNA(Tyr) deacylase (EC 3.1.-.-) | 32 | 0.80 | 2 | RW1_MOUSE (O70472) RW1 protein | 30 | 4.0 |
---|
>DTD_LACAC (Q5FKI6) D-tyrosyl-tRNA(Tyr) deacylase (EC 3.1.-.-)| Length = 145 Score = 32.3 bits (72), Expect = 0.80 Identities = 16/51 (31%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = +2 Query: 248 DIHREVLVLYEASRLMQHTEGNRPTQISFI-VPLSQELQKQSNQPRERDGF 397 D++ E+L + + + + +GNRP+ + + P+S+EL + N+ E DGF Sbjct: 68 DVNGEILSVSQFTLMANTKKGNRPSFVEAMRPPMSKELWEDFNKELENDGF 118
>RW1_MOUSE (O70472) RW1 protein| Length = 1829 Score = 30.0 bits (66), Expect = 4.0 Identities = 21/59 (35%), Positives = 29/59 (49%) Frame = +2 Query: 311 NRPTQISFIVPLSQELQKQSNQPRERDGFSLNNPTHIWRTIVYCHLLSSPSDDIRKIHL 487 NRP +S +P SQEL S+ E+D +P W V H SS +D + K+ L Sbjct: 1481 NRPVALSKFLPSSQELGNTSSSEGEKD-----SPPPEW-DAVPVHKPSSSTDSLYKLSL 1533 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,692,634 Number of Sequences: 219361 Number of extensions: 1569542 Number of successful extensions: 3527 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3526 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)