| Clone Name | rbart10c07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZN434_HUMAN (Q9NX65) Zinc finger protein 434 | 31 | 1.5 | 2 | 3CL_HUMAN (Q13412) Pre-T/NK cell-associated protein 3Cl | 28 | 9.9 |
|---|
>ZN434_HUMAN (Q9NX65) Zinc finger protein 434| Length = 485 Score = 30.8 bits (68), Expect = 1.5 Identities = 20/57 (35%), Positives = 24/57 (42%), Gaps = 4/57 (7%) Frame = +2 Query: 146 SRLYKARSGHPRDTRERQCHDDRIHQSDK*PSQEAIKRK----RPAACTRRHCGDPC 304 S L K P T RQC + +K PSQE + + R ACT CG C Sbjct: 237 SELQKGLESEP--TSRRQCRNSPGESEEKTPSQEKMSHQSFCARDKACTHILCGKNC 291
>3CL_HUMAN (Q13412) Pre-T/NK cell-associated protein 3Cl| Length = 51 Score = 28.1 bits (61), Expect = 9.9 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -2 Query: 315 QEQPQGSPQWR---RVQAAGRLRLIASWLGYLSL*WMRSSWHCRSRVS 181 QE WR R ++ R + I SWL YLS + +SW+C+ ++S Sbjct: 5 QETVYSCEYWRTFKRYFSSWRFK-IRSWLTYLSWGLLCTSWYCKVKMS 51 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,772,209 Number of Sequences: 219361 Number of extensions: 650362 Number of successful extensions: 1241 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1232 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1241 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)