ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart10c01 |
|---|---|
| Clone Library Name | barley_pub |
>ZRP4_MAIZE (P47917) O-methyltransferase ZRP4 (EC 2.1.1.-) (OMT)| Length = 364 Score = 56.6 bits (135), Expect = 3e-08 Identities = 24/48 (50%), Positives = 36/48 (75%) Frame = -3 Query: 436 LMDVAMMVMTNGRQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 293 + DV +M + NG +RDE +WS+IF +AG+SDY+++ LG R + EVYP Sbjct: 318 IFDVYIMFI-NGMERDEQEWSKIFSEAGYSDYRIIPVLGVRSIIEVYP 364
>7OMT9_MEDSA (O22309) Isoflavone-7-O-methytransferase 9 (EC 2.1.1.150)| (Isoflavone-O-methytransferase 9) (7 IOMT-9) Length = 352 Score = 49.3 bits (116), Expect = 4e-06 Identities = 22/49 (44%), Positives = 33/49 (67%) Frame = -3 Query: 439 LLMDVAMMVMTNGRQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 293 LLMDV M + NG++R+E +W ++FI+AGF YK+ G + E+YP Sbjct: 305 LLMDVNMACL-NGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 352
>7OMT8_MEDSA (O24529) Isoflavone-7-O-methytransferase 8 (EC 2.1.1.150)| (Isoflavone-O-methytransferase 8) (7-IOMT-8) Length = 352 Score = 49.3 bits (116), Expect = 4e-06 Identities = 22/49 (44%), Positives = 33/49 (67%) Frame = -3 Query: 439 LLMDVAMMVMTNGRQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 293 LLMDV M + NG++R+E +W ++FI+AGF YK+ G + E+YP Sbjct: 305 LLMDVNMACL-NGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 352
>7OMT6_MEDSA (O22308) Isoflavone-7-O-methytransferase 6 (EC 2.1.1.150)| (Isoflavone-O-methytransferase 6) (7-IOMT-6) Length = 352 Score = 49.3 bits (116), Expect = 4e-06 Identities = 22/49 (44%), Positives = 33/49 (67%) Frame = -3 Query: 439 LLMDVAMMVMTNGRQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 293 LLMDV M + NG++R+E +W ++FI+AGF YK+ G + E+YP Sbjct: 305 LLMDVNMACL-NGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 352
>EOMT1_OCIBA (Q93WU2) Eugenol O-methyltransferase (EC 2.1.1.146) ((Iso)eugenol| O-methyltransferase EOMT1) (S-adenosysl-L-methionine:(Iso)eugenol O-methyltransferase EOMT1) Length = 357 Score = 44.3 bits (103), Expect = 1e-04 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = -3 Query: 439 LLMDVAMMVMTNGRQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 293 L D+AMM N ++R ++W ++ AGF YK+ G R + E YP Sbjct: 309 LHFDMAMMCYFNAKERTMSEWEKLIYDAGFKSYKLTPAFGVRSLIEAYP 357
>CVMT1_OCIBA (Q93WU3) Chavicol O-methyltransferase (EC 2.1.1.146) ((Iso)eugenol| O-methyltransferase CVOMT1) (S-adenosysl-L-methionine:(Iso)eugenol O-methyltransferase CVOMT1) Length = 356 Score = 43.5 bits (101), Expect = 2e-04 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = -3 Query: 439 LLMDVAMMVMTNGRQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 293 L D+AMM N ++R +W ++ AGF+ YK+ G R + E YP Sbjct: 308 LHFDMAMMSYFNAKERTMNEWEKLISAAGFTSYKLTPAFGVRSLIEAYP 356
>6OMT_COPJA (Q9LEL6) (RS)-norcoclaurine 6-O-methyltransferase (EC 2.1.1.128)| (S-adenosyl-L-methionine:norcoclaurine 6-O-methyltransferase) (6-OMT) Length = 347 Score = 42.0 bits (97), Expect = 7e-04 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = -3 Query: 439 LLMDVAMMVMTNGRQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 293 L +D+ MM+ T G++R E +W ++ AG+ +K+ + + V E YP Sbjct: 298 LTLDLDMMLNTGGKERTEEEWKKLIHDAGYKGHKITQITAVQSVIEAYP 346
>4OMT_COPJA (Q9LEL5) 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase| (EC 2.1.1.116) (S-adenosyl-L-methionine:3'-hydroxy-N-methylcoclaurine 4'-O-methyltransferase) (4'-OMT) Length = 350 Score = 40.0 bits (92), Expect = 0.003 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = -3 Query: 439 LLMDVAMMVMTNGRQRDETDWSEIFIKAGFSDYKVVKKLGARGVFEVYP 293 L++D+ M+V T G++R + W +I AGFS K+ + V EV+P Sbjct: 302 LILDIDMLVNTGGKERTKEVWEKIVKSAGFSGCKIRHIAAIQSVIEVFP 350
>NFKB2_MOUSE (Q9WTK5) Nuclear factor NF-kappa-B p100 subunit (DNA-binding factor| KBF2) [Contains: Nuclear factor NF-kappa-B p52 subunit] Length = 899 Score = 29.3 bits (64), Expect = 4.5 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -1 Query: 342 IKL*RN*ELEVSLRSTRERQDQKYGSELIEANSIQYCPEAAP 217 ++L + E L ST ++D YGS+ +E + + CP P Sbjct: 844 VRLLKGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLCPPPEP 885
>TCMN_STRGA (P16559) Multifunctional cyclase-dehydratase-3-O-methyl transferase| tcmN Length = 494 Score = 29.3 bits (64), Expect = 4.5 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = -3 Query: 436 LMDVAMMVMTNGRQRDETDWSEIFIKAGF 350 L+D+ M+V+ GR+R +W ++ ++A F Sbjct: 448 LLDIDMLVLFGGRERVLAEWRQLLLEADF 476
>QUEA_CLOPE (Q8XJ15) S-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC| 5.-.-.-) (Queuosine biosynthesis protein queA) Length = 341 Score = 29.3 bits (64), Expect = 4.5 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = -3 Query: 406 NGRQRDETDWSEIFIKAGFSDYKVVKKL 323 NGR R+++ W++IFI G+ +K+V L Sbjct: 267 NGRVREQSGWTDIFIYPGYK-FKIVDNL 293
>CHOMT_MEDSA (P93324) Isoliquiritigenin 2'-O-methyltransferase (EC 2.1.1.-)| (Chalcone O-methyltransferase) (ChOMT) Length = 372 Score = 28.9 bits (63), Expect = 5.9 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -3 Query: 433 MDVAMMVMTNGRQRDETDWSEIFIKAGFSDYKVV-KKLGARGVFEVY 296 +D M + GR+R E + ++ +GFS ++V + + GV E Y Sbjct: 325 LDNLMFITVGGRERTEKQYEKLSKLSGFSKFQVACRAFNSLGVMEFY 371 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,540,449 Number of Sequences: 219361 Number of extensions: 1326378 Number of successful extensions: 2831 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2831 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
