| Clone Name | rbart10a01 |
|---|---|
| Clone Library Name | barley_pub |
>COX1_CANFA (Q9ZZ64) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 514 Score = 29.3 bits (64), Expect = 2.7 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 79 GYTNNDQNAQLHNDNLFISTIMSYYHEKRKGLSG 180 GYT ND A++H +F+ M+++ + GLSG Sbjct: 402 GYTLNDTWAKIHFTIMFVGVNMTFFPQHFLGLSG 435
>COX1_MACRO (P92661) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 513 Score = 29.3 bits (64), Expect = 2.7 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 79 GYTNNDQNAQLHNDNLFISTIMSYYHEKRKGLSG 180 GYT ND A++H +F+ M+++ + GLSG Sbjct: 402 GYTLNDLWAKIHFSIMFVGVNMTFFPQHFLGLSG 435
>COX1_SHEEP (O78749) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 514 Score = 28.9 bits (63), Expect = 3.5 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 79 GYTNNDQNAQLHNDNLFISTIMSYYHEKRKGLSG 180 GYT ND A++H +F+ M+++ + GLSG Sbjct: 402 GYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSG 435
>COX1_BOVIN (P00396) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 514 Score = 28.9 bits (63), Expect = 3.5 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 79 GYTNNDQNAQLHNDNLFISTIMSYYHEKRKGLSG 180 GYT ND A++H +F+ M+++ + GLSG Sbjct: 402 GYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSG 435
>MUTS_THEAQ (Q56215) DNA mismatch repair protein mutS| Length = 811 Score = 28.9 bits (63), Expect = 3.5 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +3 Query: 132 LYDNVLLP*KKERPKRVLISTSLKIAEGLFCSIITKRFPSSLAQAP 269 LYD + + RP VL++ L + G F KRFP L++AP Sbjct: 166 LYDELF----RHRPAEVLLAPEL-LENGAFLDEFRKRFPVMLSEAP 206
>OSTA_XANCP (Q8PCE0) Organic solvent tolerance protein precursor| Length = 809 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 248 RKPFRYYTTEEAFGYFEAGADQHPLR 171 R+P Y+T E+ FG FEAG +R Sbjct: 382 RQPRAYFTWEKPFGIFEAGVYAEAVR 407
>OSTA_XANAC (Q8PP22) Organic solvent tolerance protein precursor| Length = 813 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 248 RKPFRYYTTEEAFGYFEAGADQHPLR 171 R+P Y+T E+ FG FEAG +R Sbjct: 382 RQPRAYFTWEKPFGIFEAGVYAEAVR 407 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,560,418 Number of Sequences: 219361 Number of extensions: 582033 Number of successful extensions: 1242 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1242 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)