Clone Name | rbart09h12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CD248_HUMAN (Q9HCU0) Endosialin precursor (Tumor endothelial mar... | 28 | 7.7 |
---|
>CD248_HUMAN (Q9HCU0) Endosialin precursor (Tumor endothelial marker 1) (CD248| antigen) Length = 757 Score = 28.5 bits (62), Expect = 7.7 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 223 SAMHSAHSPDPMQVAIPVLLIISASPTNNTPPHKHTHGH 339 S H P Q A L+ S SPTN T P TH H Sbjct: 601 SPAHQISVPAATQPAALPTLLPSQSPTNQTSPISPTHPH 639 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,990,248 Number of Sequences: 219361 Number of extensions: 486791 Number of successful extensions: 1246 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1209 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1242 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)