Clone Name | rbart09g05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YL185_MIMIV (Q5URB5) Hypothetical protein L185 | 28 | 8.9 | 2 | PPCK_STAEQ (Q5HNB7) Phosphoenolpyruvate carboxykinase [ATP] (EC ... | 28 | 8.9 |
---|
>YL185_MIMIV (Q5URB5) Hypothetical protein L185| Length = 392 Score = 28.5 bits (62), Expect = 8.9 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +1 Query: 361 DLRQDLLFKDGIILLQLDHGLLTKSINLVIILL 459 D DL+F + +ILL ++G +I++V ILL Sbjct: 147 DTNNDLIFNNDLILLIFEYGFFEDTIDVVKILL 179
>PPCK_STAEQ (Q5HNB7) Phosphoenolpyruvate carboxykinase [ATP] (EC 4.1.1.49) (PEP| carboxykinase) (Phosphoenolpyruvate carboxylase) (PEPCK) Length = 530 Score = 28.5 bits (62), Expect = 8.9 Identities = 18/47 (38%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +1 Query: 133 KISNNEDQHFSTGMTPLHKKIRKPHLXVLVS-SSIN*KTGAMT*NHP 270 K+ HF T L+KKI K H L +IN KTG T P Sbjct: 14 KLIEKATSHFQLSSTQLYKKILKNHEGELTELGAINVKTGKYTGRSP 60 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,023,631 Number of Sequences: 219361 Number of extensions: 1001817 Number of successful extensions: 2358 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2356 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)