| Clone Name | rbart09e05 |
|---|---|
| Clone Library Name | barley_pub |
>UCP2_RAT (P56500) Mitochondrial uncoupling protein 2 (UCP 2)| Length = 309 Score = 49.7 bits (117), Expect = 2e-06 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFV 215 FYKGF+P+F R GSWNV+MF+T EQ+++A + Sbjct: 269 FYKGFMPSFLRLGSWNVVMFVTYEQLKRALM 299
>UCP2_PIG (O97562) Mitochondrial uncoupling protein 2 (UCP 2)| Length = 309 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/37 (54%), Positives = 29/37 (78%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFVRKPANK 197 FYKGF P+F R GSWNV+MF+T EQ+++A + A++ Sbjct: 269 FYKGFTPSFLRLGSWNVVMFVTYEQLKRALMAARASR 305
>UCP2_MOUSE (P70406) Mitochondrial uncoupling protein 2 (UCP 2) (UCPH)| Length = 309 Score = 49.7 bits (117), Expect = 2e-06 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFV 215 FYKGF+P+F R GSWNV+MF+T EQ+++A + Sbjct: 269 FYKGFMPSFLRLGSWNVVMFVTYEQLKRALM 299
>UCP2_HUMAN (P55851) Mitochondrial uncoupling protein 2 (UCP 2) (UCPH)| Length = 309 Score = 49.7 bits (117), Expect = 2e-06 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFV 215 FYKGF+P+F R GSWNV+MF+T EQ+++A + Sbjct: 269 FYKGFMPSFLRLGSWNVVMFVTYEQLKRALM 299
>UCP2_CANFA (Q9N2J1) Mitochondrial uncoupling protein 2 (UCP 2)| Length = 309 Score = 49.7 bits (117), Expect = 2e-06 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFV 215 FYKGF+P+F R GSWNV+MF+T EQ+++A + Sbjct: 269 FYKGFMPSFLRLGSWNVVMFVTYEQLKRALM 299
>UCP3_RAT (P56499) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 308 Score = 49.7 bits (117), Expect = 2e-06 Identities = 19/32 (59%), Positives = 28/32 (87%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFVR 212 FYKGF+P+F R GSWNV+MF+T EQ+++A ++ Sbjct: 268 FYKGFMPSFLRLGSWNVMMFVTYEQLKRALMK 299
>UCP2_CYPCA (Q9W725) Mitochondrial uncoupling protein 2 (UCP 2)| Length = 310 Score = 49.7 bits (117), Expect = 2e-06 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFV 215 FYKGF+P+F R GSWNV+MF+T EQ+++A + Sbjct: 270 FYKGFMPSFLRLGSWNVVMFVTYEQLKRAMM 300
>UCP3_HUMAN (P55916) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 312 Score = 49.3 bits (116), Expect = 2e-06 Identities = 19/32 (59%), Positives = 27/32 (84%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFVR 212 FYKGF P+F R GSWNV+MF+T EQ+++A ++ Sbjct: 272 FYKGFTPSFLRLGSWNVVMFVTYEQLKRALMK 303
>UCP3_BOVIN (O77792) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 311 Score = 49.3 bits (116), Expect = 2e-06 Identities = 19/32 (59%), Positives = 27/32 (84%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFVR 212 FYKGF P+F R GSWNV+MF+T EQ+++A ++ Sbjct: 271 FYKGFTPSFLRLGSWNVVMFVTYEQMKRALMK 302
>UCP2_BRARE (Q9W720) Mitochondrial uncoupling protein 2 (UCP 2)| Length = 310 Score = 48.5 bits (114), Expect = 4e-06 Identities = 19/36 (52%), Positives = 28/36 (77%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFVRKPAN 200 F+KGF+P+F R GSWNV+MF+T EQ+++A + N Sbjct: 270 FFKGFMPSFLRLGSWNVVMFVTYEQLKRAMMAARQN 305
>UCP3_CANFA (Q9N2I9) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 311 Score = 48.1 bits (113), Expect = 5e-06 Identities = 18/32 (56%), Positives = 27/32 (84%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFVR 212 FYKGF P+F R G+WNV+MF+T EQ+++A ++ Sbjct: 271 FYKGFTPSFLRLGTWNVVMFVTYEQLKRALMK 302
>UCP3_MOUSE (P56501) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 308 Score = 48.1 bits (113), Expect = 5e-06 Identities = 18/32 (56%), Positives = 28/32 (87%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFVR 212 FYKGF+P+F R G+WNV+MF+T EQ+++A ++ Sbjct: 268 FYKGFVPSFLRLGAWNVMMFVTYEQLKRALMK 299
>UCP3_PIG (O97649) Mitochondrial uncoupling protein 3 (UCP 3)| Length = 308 Score = 47.8 bits (112), Expect = 7e-06 Identities = 18/32 (56%), Positives = 27/32 (84%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFVR 212 FYKGF P+F R GSWNV+MF++ EQ+++A ++ Sbjct: 268 FYKGFTPSFLRLGSWNVVMFVSYEQLKRALMK 299
>UCP1_RAT (P04633) Mitochondrial brown fat uncoupling protein 1 (UCP 1)| (Thermogenin) Length = 306 Score = 45.4 bits (106), Expect = 4e-05 Identities = 18/32 (56%), Positives = 25/32 (78%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFVR 212 F+KGF P+F R GSWNVIMF+ EQ++K ++ Sbjct: 266 FFKGFAPSFLRLGSWNVIMFVCFEQLKKELMK 297
>UCP1_CANFA (Q9GMZ1) Mitochondrial brown fat uncoupling protein 1 (UCP 1)| (Thermogenin) Length = 309 Score = 45.1 bits (105), Expect = 5e-05 Identities = 17/32 (53%), Positives = 26/32 (81%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFVR 212 F+KGF+P+F R GSWNVIMF+ EQ+++ ++ Sbjct: 269 FFKGFVPSFLRLGSWNVIMFVCFEQLKRELMK 300
>UCP1_PHOSU (Q9ER18) Mitochondrial brown fat uncoupling protein 1 (UCP 1)| (Thermogenin) Length = 307 Score = 43.9 bits (102), Expect = 1e-04 Identities = 17/32 (53%), Positives = 25/32 (78%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFVR 212 F+KGF+P+F R SWNVIMF+ EQ++K ++ Sbjct: 267 FFKGFVPSFLRLASWNVIMFVCFEQLKKELMK 298
>UCP1_DICGR (Q8K404) Mitochondrial brown fat uncoupling protein 1 (UCP 1)| (Thermogenin) Length = 307 Score = 43.9 bits (102), Expect = 1e-04 Identities = 17/32 (53%), Positives = 25/32 (78%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFVR 212 F+KGF+P+F R SWNVIMF+ EQ++K ++ Sbjct: 267 FFKGFVPSFLRLASWNVIMFVCFEQLKKELMK 298
>UCP1_RABIT (P14271) Mitochondrial brown fat uncoupling protein 1 (UCP 1)| (Thermogenin) Length = 306 Score = 43.1 bits (100), Expect = 2e-04 Identities = 17/32 (53%), Positives = 25/32 (78%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFVR 212 F+KGF+P+F R GSWNVIMF+ E+++ +R Sbjct: 266 FFKGFVPSFLRLGSWNVIMFVCFEKLKGELMR 297
>UCP1_MOUSE (P12242) Mitochondrial brown fat uncoupling protein 1 (UCP 1)| (Thermogenin) Length = 306 Score = 43.1 bits (100), Expect = 2e-04 Identities = 17/32 (53%), Positives = 25/32 (78%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFVR 212 F+KGF+ +F R GSWNVIMF+ EQ++K ++ Sbjct: 266 FFKGFVASFLRLGSWNVIMFVCFEQLKKELMK 297
>UCP1_MESAU (P04575) Mitochondrial brown fat uncoupling protein 1 (UCP 1)| (Thermogenin) Length = 306 Score = 43.1 bits (100), Expect = 2e-04 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQK 224 F+KGF+P+F R SWNVIMF+ EQ++K Sbjct: 266 FFKGFVPSFLRLASWNVIMFVCFEQLKK 293
>UCP1_HUMAN (P25874) Mitochondrial brown fat uncoupling protein 1 (UCP 1)| (Thermogenin) Length = 307 Score = 42.0 bits (97), Expect = 4e-04 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQK 224 F+KG +P+F R GSWNVIMF+ EQ+++ Sbjct: 267 FFKGLVPSFLRLGSWNVIMFVCFEQLKR 294
>UCP5_MOUSE (Q9Z2B2) Brain mitochondrial carrier protein 1 (BMCP-1)| (Mitochondrial uncoupling protein 5) (UCP 5) (Solute carrier family 25 member 14) Length = 325 Score = 40.4 bits (93), Expect = 0.001 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = -2 Query: 304 YKGFLPNFARRGSWNVIMFLTLEQVQK 224 YKGF PN+ R G WN+I F+T EQ+++ Sbjct: 296 YKGFWPNWLRLGPWNIIFFITYEQLKR 322
>UCP5_HUMAN (O95258) Brain mitochondrial carrier protein 1 (BMCP-1)| (Mitochondrial uncoupling protein 5) (UCP 5) (Solute carrier family 25 member 14) Length = 325 Score = 40.4 bits (93), Expect = 0.001 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = -2 Query: 304 YKGFLPNFARRGSWNVIMFLTLEQVQK 224 YKGF PN+ R G WN+I F+T EQ+++ Sbjct: 296 YKGFWPNWLRLGPWNIIFFITYEQLKR 322
>UCP1_BOVIN (P10861) Mitochondrial brown fat uncoupling protein 1 (UCP 1)| (Thermogenin) (Fragment) Length = 288 Score = 37.0 bits (84), Expect = 0.013 Identities = 15/32 (46%), Positives = 25/32 (78%) Frame = -2 Query: 307 FYKGFLPNFARRGSWNVIMFLTLEQVQKAFVR 212 F+KGF+P+F R GSWN IMF+ E++++ ++ Sbjct: 249 FFKGFVPSFLRLGSWN-IMFVCFERLKQELMK 279
>M2OM_RAT (P97700) Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP)| (Solute carrier family 25 member 11) Length = 313 Score = 34.3 bits (77), Expect = 0.082 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = -2 Query: 304 YKGFLPNFARRGSWNVIMFLTLEQVQKAFVR 212 +KGF P +AR G V+ F+ LEQ+ KA+ R Sbjct: 278 WKGFTPYYARLGPHTVLTFIFLEQMNKAYKR 308
>M2OM_MOUSE (Q9CR62) Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP)| (Solute carrier family 25 member 11) Length = 313 Score = 34.3 bits (77), Expect = 0.082 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = -2 Query: 304 YKGFLPNFARRGSWNVIMFLTLEQVQKAFVR 212 +KGF P +AR G V+ F+ LEQ+ KA+ R Sbjct: 278 WKGFTPYYARLGPHTVLTFIFLEQMNKAYKR 308
>M2OM_HUMAN (Q02978) Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP)| (Solute carrier family 25 member 11) Length = 313 Score = 34.3 bits (77), Expect = 0.082 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = -2 Query: 304 YKGFLPNFARRGSWNVIMFLTLEQVQKAFVR 212 +KGF P +AR G V+ F+ LEQ+ KA+ R Sbjct: 278 WKGFTPYYARLGPHTVLTFIFLEQMNKAYKR 308
>M2OM_BOVIN (P22292) Mitochondrial 2-oxoglutarate/malate carrier protein (OGCP)| (Solute carrier family 25 member 11) Length = 313 Score = 34.3 bits (77), Expect = 0.082 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = -2 Query: 304 YKGFLPNFARRGSWNVIMFLTLEQVQKAFVR 212 +KGF P +AR G V+ F+ LEQ+ KA+ R Sbjct: 278 WKGFTPYYARLGPHTVLTFIFLEQMNKAYKR 308
>UCP4_HUMAN (O95847) Mitochondrial uncoupling protein 4 (UCP 4) (Solute carrier| family 25 member 27) Length = 323 Score = 32.7 bits (73), Expect = 0.24 Identities = 11/27 (40%), Positives = 21/27 (77%) Frame = -2 Query: 304 YKGFLPNFARRGSWNVIMFLTLEQVQK 224 YKGFLP++ R W+++ +LT E++++ Sbjct: 290 YKGFLPSWLRMTPWSMVFWLTYEKIRE 316
>DIC1_YEAST (Q06143) Mitochondrial dicarboxylate transporter (Dicarboxylate| carrier 1) (DTP) Length = 298 Score = 32.0 bits (71), Expect = 0.41 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = -2 Query: 304 YKGFLPNFARRGSWNVIMFLTLEQVQKAFVRKP 206 ++G+LP+F R G + +++F +EQ++K V P Sbjct: 262 FRGWLPSFTRLGPFTMLIFFAIEQLKKHRVGMP 294
>ATRN_HUMAN (O75882) Attractin precursor (Mahogany homolog) (DPPT-L)| Length = 1429 Score = 30.4 bits (67), Expect = 1.2 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 2/71 (2%) Frame = +1 Query: 25 LFKGLSRATKIYYSFSRVRAQICPLDLNSQGLTPYVGKNK--CAHWCWIPPSTKPYQLNA 198 L L+ K+ + ++R ++ LTP+VG K ++WCW P+ N+ Sbjct: 822 LLASLTTQKKVEFVLKQLRIMQSSQSMSKLTLTPWVGLRKINVSYWCW--EDMSPF-TNS 878 Query: 199 YLQAFSQRPSE 231 LQ PS+ Sbjct: 879 LLQWMPSEPSD 889
>ATRN_MOUSE (Q9WU60) Attractin precursor (Mahogany protein)| Length = 1428 Score = 29.3 bits (64), Expect = 2.6 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 2/67 (2%) Frame = +1 Query: 37 LSRATKIYYSFSRVRAQICPLDLNSQGLTPYVGKNK--CAHWCWIPPSTKPYQLNAYLQA 210 L+ K+ + ++R ++ LTP+VG K ++WCW P+ N+ LQ Sbjct: 825 LTSQKKVEFVLKQLRLMQSSQSMSKLTLTPWVGLRKINVSYWCW--EDMSPF-TNSLLQW 881 Query: 211 FSQRPSE 231 PS+ Sbjct: 882 MPSEPSD 888
>SYI_EHRCJ (Q3YRX3) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 1120 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 44 ERPKFITVSHG*GLKFVLWTSTP 112 E PKFITV + K ++WT+TP Sbjct: 232 ESPKFITVENVKTYKILVWTTTP 254
>DIC1_CANGA (Q6FTN2) Mitochondrial dicarboxylate transporter (Dicarboxylate| carrier 1) Length = 295 Score = 28.5 bits (62), Expect = 4.5 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = -2 Query: 304 YKGFLPNFARRGSWNVIMFLTLEQVQKAFVRKP 206 ++G++P+F R + +++F +EQ++K V P Sbjct: 259 FRGWVPSFTRLAPFTMLIFFAMEQLKKYRVGMP 291
>KSGA_THETN (Q8RDC8) Dimethyladenosine transferase (EC 2.1.1.-)| (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) (16S rRNA dimethylase) (High level kasugamycin resistance protein ksgA) (Kasugamycin dimethyltransferase) Length = 268 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -1 Query: 284 LR*TGIMERDYVLDTGAGSEGLCEKACK 201 +R +G+ E D+VL+ G G GL E+ K Sbjct: 22 VRASGVGEEDFVLEVGTGHGGLTEELAK 49
>BAS1_YEAST (P22035) Myb-like DNA-binding protein BAS1| Length = 811 Score = 27.7 bits (60), Expect = 7.7 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +1 Query: 118 LTPYVGKNKCAHWCWIPPSTKPY 186 + P VG N+ AH+ ++PP+ +P+ Sbjct: 615 MPPDVGPNRIAHFNYLPPTIRPH 637
>POLG_YEFV2 (P19901) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3411 Score = 27.7 bits (60), Expect = 7.7 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 4/76 (5%) Frame = +3 Query: 42 KSDQNLLQFLTGEGSNLSFGPQLPRVNALCRKKQMCTLVLDTTLYQTISTQRLFAG---- 209 K +L F G G F LP++ A C ++++ TLVL T + F G Sbjct: 1674 KGMTTVLDFHPGAGKTRRF---LPQILAECARRRLRTLVLAPTRVVLSEMKEAFHGLDVK 1730 Query: 210 FLTKAF*TCSSVKNII 257 F T+AF S + +I Sbjct: 1731 FHTQAFSAHGSGREVI 1746
>POLG_YEFV1 (P03314) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3411 Score = 27.7 bits (60), Expect = 7.7 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 4/76 (5%) Frame = +3 Query: 42 KSDQNLLQFLTGEGSNLSFGPQLPRVNALCRKKQMCTLVLDTTLYQTISTQRLFAG---- 209 K +L F G G F LP++ A C ++++ TLVL T + F G Sbjct: 1674 KGMTTVLDFHPGAGKTRRF---LPQILAECARRRLRTLVLAPTRVVLSEMKEAFHGLDVK 1730 Query: 210 FLTKAF*TCSSVKNII 257 F T+AF S + +I Sbjct: 1731 FHTQAFSAHGSGREVI 1746
>SCOB_BACSU (P42316) Probable succinyl-CoA:3-ketoacid-coenzyme A transferase| subunit B (EC 2.8.3.5) (Succinyl CoA:3-oxoacid CoA-transferase) (OXCT B) Length = 216 Score = 27.3 bits (59), Expect = 10.0 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +2 Query: 32 RAYQERPKFITVSHG*GLKFVLWTSTPKG*RLM*EKTNVHIGVGYHPLPNHINSTLI 202 RA QE + V+ G G+ ++ P G +M + N +G+G +PL ++ LI Sbjct: 11 RAVQEIKDGMNVNLGIGMPTLVANEIPDGVHVMLQSENGLLGIGPYPLEGTEDADLI 67
>CYSH_SYNP7 (Q55309) Phosphoadenosine phosphosulfate reductase (EC 1.8.4.8)| (PAPS reductase, thioredoxin dependent) (PAdoPS reductase) (3'-phosphoadenylylsulfate reductase) (PAPS sulfotransferase) Length = 232 Score = 27.3 bits (59), Expect = 10.0 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -3 Query: 207 LQISVELIWFGRGWYPTPMCTFVFSYIRR*PLGVEVQRTNLSP 79 +Q + +IW G+ PT F R L ++V ++ +SP Sbjct: 55 VQPDIPVIWIDTGYLPTETYRFAAELTERLKLNLKVYQSEISP 97 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,603,393 Number of Sequences: 219361 Number of extensions: 926189 Number of successful extensions: 2022 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 1979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2022 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)