Clone Name | rbart09d12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NU5M_PAPHA (Q95885) NADH-ubiquinone oxidoreductase chain 5 (EC 1... | 27 | 9.5 |
---|
>NU5M_PAPHA (Q95885) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 603 Score = 27.3 bits (59), Expect = 9.5 Identities = 18/75 (24%), Positives = 35/75 (46%), Gaps = 5/75 (6%) Frame = +2 Query: 101 PYQSETVYQTHPVFYNMLHVCVSSMLYE-RRKQHLH----LIFTLPSTSRTELVVHLLIT 265 PY + TH F ML +C S+++ +Q + L T+P TS + ++ +L +T Sbjct: 322 PYLAFLHICTHAFFKAMLFICSGSIIHNLNNEQDIRKMGGLFKTMPLTSTSLIIGNLALT 381 Query: 266 RVLFTHALVGRRAVV 310 + F + ++ Sbjct: 382 GIPFLTGFYSKDLII 396 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,412,803 Number of Sequences: 219361 Number of extensions: 860914 Number of successful extensions: 1454 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1454 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)