Clone Name | rbart09d09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PCDB1_PANTR (Q5DRE0) Protocadherin beta 1 precursor (PCDH-beta1) | 29 | 2.9 | 2 | PCDB1_HUMAN (Q9Y5F3) Protocadherin beta 1 precursor (PCDH-beta1) | 29 | 2.9 | 3 | CCNA1_HUMAN (P78396) Cyclin-A1 | 28 | 8.5 |
---|
>PCDB1_PANTR (Q5DRE0) Protocadherin beta 1 precursor (PCDH-beta1)| Length = 818 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -1 Query: 190 PETRGKGMSAPMDEEEPKEATVAACTVNDADCNSG 86 PE +S+P+ E+ P + VA T+ D D G Sbjct: 345 PEVMVSSVSSPLPEDSPPQTVVALFTIRDRDIRVG 379
>PCDB1_HUMAN (Q9Y5F3) Protocadherin beta 1 precursor (PCDH-beta1)| Length = 818 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -1 Query: 190 PETRGKGMSAPMDEEEPKEATVAACTVNDADCNSG 86 PE +S+P+ E+ P + VA T+ D D G Sbjct: 345 PEVMVSSVSSPLPEDSPPQTVVALFTIRDRDIRVG 379
>CCNA1_HUMAN (P78396) Cyclin-A1| Length = 465 Score = 27.7 bits (60), Expect = 8.5 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = +3 Query: 27 VYLIGTGTT---LYINPQFNYTRPLLQSASLTVQAATVASLGS 146 VY + TGT L+ FN P+L +SL Q+ ++SLG+ Sbjct: 161 VYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGT 203 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,998,272 Number of Sequences: 219361 Number of extensions: 405044 Number of successful extensions: 1165 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1165 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)