Clone Name | rbart08h10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZN512_MACFA (Q95JV5) Zinc finger protein 512 | 29 | 4.1 | 2 | LEUK_RAT (P13838) Leukosialin precursor (Leucocyte sialoglycopro... | 29 | 4.1 | 3 | K0133_HUMAN (Q14146) Protein KIAA0133 | 29 | 5.4 | 4 | YEHY_ECOLI (P33361) Inner membrane ABC transporter permease prot... | 28 | 7.1 | 5 | CAC1B_HUMAN (Q00975) Voltage-dependent N-type calcium channel al... | 28 | 9.2 |
---|
>ZN512_MACFA (Q95JV5) Zinc finger protein 512| Length = 565 Score = 29.3 bits (64), Expect = 4.1 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +1 Query: 160 KNRTANNIMDGWLQASVEHSPAVTSFRAVFRCQPIMRSNLPPSF 291 KNRT +I D Q ++ H +++ + C+P+ S+ P SF Sbjct: 29 KNRTQCSIKDNSFQYTIPHDDSLSGSSSASSCEPV--SDFPASF 70
>LEUK_RAT (P13838) Leukosialin precursor (Leucocyte sialoglycoprotein)| (Sialophorin) (W3/13 antigen) (CD43 antigen) (Fragment) Length = 378 Score = 29.3 bits (64), Expect = 4.1 Identities = 15/57 (26%), Positives = 28/57 (49%) Frame = -2 Query: 240 PERGDGGAVLYTCLKPAVHDIVCCSVLLLFITIILLWNNGGECKTGGCWCVQGRRRN 70 P G G +L + L + +V+L+ + ++LLW + +TG +G +RN Sbjct: 225 PRPGSSGMLLVSML-------IALTVVLVLVALLLLWRQRQKRRTGALTLSRGGKRN 274
>K0133_HUMAN (Q14146) Protein KIAA0133| Length = 1524 Score = 28.9 bits (63), Expect = 5.4 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = -2 Query: 222 GAVLYTCLKPAVHDIVCCSVLLLFITIILLWNNGGECKTGGCWCVQGRRRNCL 64 GAVL C P SVL+ ++ +L + G C+ GG QG R L Sbjct: 1096 GAVLQLCSVPGARGWRLPSVLISSVSTLLEADLGQHCRDGGADISQGSDRTLL 1148
>YEHY_ECOLI (P33361) Inner membrane ABC transporter permease protein yehY| Length = 385 Score = 28.5 bits (62), Expect = 7.1 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -2 Query: 231 GDGGAVLYTCLKPAVHDIVCCSVLLLFITIILLWNNG 121 G G A L C P +C +L F+ ++L+W G Sbjct: 54 GVGCAWLTACFIPGKKGSICALILAQFVFVLLVWGAG 90
>CAC1B_HUMAN (Q00975) Voltage-dependent N-type calcium channel alpha-1B subunit| (Voltage-gated calcium channel alpha subunit Cav2.2) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Brain calcium channel III) (BIII) Length = 2339 Score = 28.1 bits (61), Expect = 9.2 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 424 GEEGARRHRLQEEQAPARQAV 362 GEE ARRHR + + PA +AV Sbjct: 972 GEEPARRHRARHKAQPAHEAV 992 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,210,751 Number of Sequences: 219361 Number of extensions: 1235943 Number of successful extensions: 3145 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3034 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3142 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)