| Clone Name | rbart08h06 |
|---|---|
| Clone Library Name | barley_pub |
>TRXL1_ARATH (O64654) Thioredoxin-like 1| Length = 275 Score = 41.6 bits (96), Expect = 0.001 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = -2 Query: 463 AANKDLQFTYTKQPEPVPSGDSEFIAPGS-PRLPPPAKPLVRQGSGERTLVSSGR 302 AANK+L FTYT +P PV + E P S P LP P + + E+TLVS+GR Sbjct: 226 AANKELNFTYTPKPVPV---EKEAATPDSNPSLPVPLPSM--SSNDEKTLVSAGR 275
>ADA2B_BOVIN (O77700) Alpha-2B adrenergic receptor (Alpha-2B adrenoceptor)| (Alpha-2B adrenoreceptor) (Fragment) Length = 392 Score = 31.2 bits (69), Expect = 1.4 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 427 QPEPVPSGDSEFI-APGSPRLPPPAKPLVRQGSGER 323 QP P GD E APG+P LPP + + G G++ Sbjct: 239 QPRPGEKGDGETPEAPGTPALPPSWPAIPKSGQGQK 274
>SPT5H_CHICK (Q5ZI08) Transcription elongation factor SPT5 (DRB| sensitivity-inducing factor large subunit) (DSIF large subunit) Length = 1079 Score = 30.8 bits (68), Expect = 1.8 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = -2 Query: 460 ANKDLQFTYTKQPEPVPSGDSEFIAPGSPRLPPPAKPLVRQGSGERT 320 A++D ++ + +P P P G P +P P P+ P V Q +T Sbjct: 824 ADEDFEYGFDDEPTPSPQGYGGTPNPQTPGYPDPSSPQVTQPYNPQT 870
>LX15B_HUMAN (O15296) Arachidonate 15-lipoxygenase type II (EC 1.13.11.33)| (15-LOX-2) (15-lipoxygenase 2) Length = 676 Score = 30.0 bits (66), Expect = 3.1 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 323 PLSGTL-PNQWFCRWRKPWAPRSNELGITTRNW 418 PL G L P+ WFCRW + PR L W Sbjct: 77 PLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQW 109
>PLD1_HUMAN (Q13393) Phospholipase D1 (EC 3.1.4.4) (PLD 1) (Choline phosphatase| 1) (Phosphatidylcholine-hydrolyzing phospholipase D1) (hPLD1) Length = 1074 Score = 30.0 bits (66), Expect = 3.1 Identities = 17/63 (26%), Positives = 33/63 (52%) Frame = +1 Query: 154 GLTSSKKSTKPALYTTMRKYNLYTPTTIEKLYREQMDAITFRPSSHHNLIFLMRPRSSLR 333 G+ +K +K +LY + +++L+ +I + +R SHHNLI ++P L Sbjct: 550 GIGKPRKFSKFSLYKQLHRHHLHDADSISSIDSTSSYFNHYR--SHHNLIHGLKPHFKLF 607 Query: 334 NPA 342 +P+ Sbjct: 608 HPS 610
>LTBP4_MOUSE (Q8K4G1) Latent transforming growth factor beta-binding protein 4| precursor (LTBP-4) Length = 1666 Score = 29.3 bits (64), Expect = 5.2 Identities = 23/50 (46%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = -2 Query: 424 PEPVPSGD---SEFIAPGSPRLP--PPAKPLVRQGSGERT-LVSSGR*DC 293 P P+G S+ AP SP LP PPA P R+ S R VSSGR +C Sbjct: 1176 PPRAPAGTFPGSQPQAPASPSLPARPPAPPPPRRPSPPRQGPVSSGRREC 1225
>ACK1_MOUSE (O54967) Activated CDC42 kinase 1 (EC 2.7.10.2) (ACK-1)| (Non-receptor protein tyrosine kinase Ack) (Tyrosine kinase non-receptor protein 2) Length = 1055 Score = 28.9 bits (63), Expect = 6.8 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = -2 Query: 418 PVPSGDSE---FIAPGSPRLPPPAKPLVRQGS 332 P PSG+ E + P SP PP +PL QGS Sbjct: 773 PAPSGEEETSRWPGPASPPRVPPREPLSPQGS 804
>CCDC6_HUMAN (Q16204) Coiled-coil domain-containing protein 6 (H4 protein)| (Papillary thyroid carcinoma-encoded protein) Length = 585 Score = 28.9 bits (63), Expect = 6.8 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -2 Query: 430 KQPEPVPSGDSEF-IAPGSPRLPPPAKPLVRQGS 332 K+P P PS +++ + P P PPP +P V GS Sbjct: 424 KRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSGS 457
>SECD_MYCTU (Q50634) Protein-export membrane protein secD| Length = 573 Score = 28.9 bits (63), Expect = 6.8 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 430 KQPEPVPSGDSEFIAPGSPRLPPPAK 353 ++P+P PS + + PG P PPPA+ Sbjct: 132 EEPQPAPSAEPQ--PPGQPAAPPPAQ 155
>IRS2_HUMAN (Q9Y4H2) Insulin receptor substrate 2 (IRS-2)| Length = 1338 Score = 28.9 bits (63), Expect = 6.8 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -2 Query: 436 YTKQPEPVPSGDSEFIAPGSP--RLPPPAKPLVRQGSGERTLVSS 308 Y PEP G+ I G P RL PPA PL+ + +L+S+ Sbjct: 907 YPLPPEPKSPGEYINIDFGEPGARLSPPAPPLLASAASSSSLLSA 951
>MYOTI_MOUSE (Q9JIF9) Myotilin (Titin immunoglobulin domain protein)| (Myofibrillar titin-like Ig domains protein) Length = 496 Score = 28.9 bits (63), Expect = 6.8 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 233 QSRNCTENRWTRSHLDRRHITISSS 307 Q R CTE R++ S HIT+SSS Sbjct: 43 QPRQCTEQRFSASSTVSSHITVSSS 67
>BLNK_CHICK (Q9YGC1) B-cell linker protein (Cytoplasmic adapter protein)| (B-cell adapter SH2 domain-containing protein) Length = 552 Score = 28.9 bits (63), Expect = 6.8 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 418 PVPSGDSEFIAPGSPRLPPPAKPLVRQ 338 PV + D +I P PPPAKP V + Sbjct: 197 PVDNDDDNYIEPTESSTPPPAKPPVNR 223
>RDR1_SCHPO (O14227) RNA-dependent RNA polymerase homolog 1 (Protein rdp1)| Length = 1215 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 4/27 (14%) Frame = +2 Query: 230 QQSRNCTENR----WTRSHLDRRHITI 298 ++S+N TE+R WT SHL RRH I Sbjct: 269 RKSKNATESRVQTFWTASHLWRRHYDI 295
>PLD1_RAT (P70496) Phospholipase D1 (EC 3.1.4.4) (PLD 1) (Choline phosphatase| 1) (Phosphatidylcholine-hydrolyzing phospholipase D1) (rPLD1) Length = 1074 Score = 28.5 bits (62), Expect = 8.9 Identities = 17/63 (26%), Positives = 31/63 (49%) Frame = +1 Query: 154 GLTSSKKSTKPALYTTMRKYNLYTPTTIEKLYREQMDAITFRPSSHHNLIFLMRPRSSLR 333 G+ S+K +K +LY + + NL+ +I + + + SH NLI ++P L Sbjct: 550 GIGKSRKFSKFSLYRQLHRRNLHNSDSISSV--DSASSYFNHYRSHQNLIHGIKPHLKLF 607 Query: 334 NPA 342 P+ Sbjct: 608 RPS 610
>LOX2_PEA (P14856) Seed lipoxygenase-2 (EC 1.13.11.12)| Length = 864 Score = 28.5 bits (62), Expect = 8.9 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 14 RNHDNSIWHSD*PIQLPYNLL 76 +N+D S++H P+QLPY LL Sbjct: 825 KNNDPSLYHRVGPVQLPYTLL 845 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,958,773 Number of Sequences: 219361 Number of extensions: 1395869 Number of successful extensions: 4940 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 4548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4923 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)