Clone Name | rbart08h05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RECA_MYCTH (Q9F407) Protein recA (Recombinase A) [Contains: Mth ... | 28 | 6.3 | 2 | SFMA_ECOLI (P0ABW5) Sfm fimbrial protein, A chain precursor (Typ... | 28 | 6.3 | 3 | SFMA_ECO57 (P0ABW6) Sfm fimbrial protein, A chain precursor (Typ... | 28 | 6.3 |
---|
>RECA_MYCTH (Q9F407) Protein recA (Recombinase A) [Contains: Mth recA intein]| (Fragment) Length = 424 Score = 28.1 bits (61), Expect = 6.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 160 GTSDQAPQGKQNALLGLGHGADQVD 234 GT P+G+ +GHGAD+VD Sbjct: 132 GTLSPDPRGRNGVRFRMGHGADRVD 156
>SFMA_ECOLI (P0ABW5) Sfm fimbrial protein, A chain precursor (Type-1A pilin)| Length = 180 Score = 28.1 bits (61), Expect = 6.3 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 79 KTNGNSCPTNMNQASSDPIHIYSHKQRGTSDQAPQGKQNA 198 K +GNS TN N + +S + +GT A G+ NA Sbjct: 132 KPDGNSFSTNQNLIPGTNVLHFSARYKGTGTSASAGQANA 171
>SFMA_ECO57 (P0ABW6) Sfm fimbrial protein, A chain precursor (Type-1A pilin)| Length = 180 Score = 28.1 bits (61), Expect = 6.3 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 79 KTNGNSCPTNMNQASSDPIHIYSHKQRGTSDQAPQGKQNA 198 K +GNS TN N + +S + +GT A G+ NA Sbjct: 132 KPDGNSFSTNQNLIPGTNVLHFSARYKGTGTSASAGQANA 171 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,223,419 Number of Sequences: 219361 Number of extensions: 720323 Number of successful extensions: 1593 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1593 length of database: 80,573,946 effective HSP length: 54 effective length of database: 68,728,452 effective search space used: 1649482848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)