Clone Name | rbart08g08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y3320_MYCBO (P65066) Hypothetical protein Mb3320 | 34 | 0.24 | 2 | Y3292_MYCTU (P65065) Hypothetical protein Rv3292/MT3391 | 34 | 0.24 |
---|
>Y3320_MYCBO (P65066) Hypothetical protein Mb3320| Length = 415 Score = 33.9 bits (76), Expect = 0.24 Identities = 25/77 (32%), Positives = 33/77 (42%), Gaps = 1/77 (1%) Frame = -2 Query: 459 AEMASNPLANAWYAGGDPSFPTEIADLCEXXXXXXXXXXXXGQLLT-DGRSGASYNLNGV 283 AEMA+ LA +Y GGDPS P D T DG A YN++ + Sbjct: 334 AEMAAQGLA--YYRGGDPSAPIVYEDFLPASAAGIFRSNLDRDSQTGDGPDDAGYNVDWL 391 Query: 282 GGRRFLVQWVWDPYRSY 232 G + + + DPY Y Sbjct: 392 AGA--IGRHIHDPYALY 406
>Y3292_MYCTU (P65065) Hypothetical protein Rv3292/MT3391| Length = 415 Score = 33.9 bits (76), Expect = 0.24 Identities = 25/77 (32%), Positives = 33/77 (42%), Gaps = 1/77 (1%) Frame = -2 Query: 459 AEMASNPLANAWYAGGDPSFPTEIADLCEXXXXXXXXXXXXGQLLT-DGRSGASYNLNGV 283 AEMA+ LA +Y GGDPS P D T DG A YN++ + Sbjct: 334 AEMAAQGLA--YYRGGDPSAPIVYEDFLPASAAGIFRSNLDRDSQTGDGPDDAGYNVDWL 391 Query: 282 GGRRFLVQWVWDPYRSY 232 G + + + DPY Y Sbjct: 392 AGA--IGRHIHDPYALY 406 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,888,528 Number of Sequences: 219361 Number of extensions: 969244 Number of successful extensions: 2916 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2867 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2916 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)