| Clone Name | rbart08g05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FUCO2_ARATH (Q9FXE5) Alpha-L-fucosidase 2 precursor (EC 3.2.1.51... | 31 | 1.4 | 2 | EMBA_MYCSM (Q50394) Probable arabinosyltransferase A (EC 2.4.2.-) | 28 | 8.8 |
|---|
>FUCO2_ARATH (Q9FXE5) Alpha-L-fucosidase 2 precursor (EC 3.2.1.51)| (Alpha-L-fucoside fucohydrolase 2) (Alpha-1,2-fucosidase) (AtFXG1) Length = 372 Score = 30.8 bits (68), Expect = 1.4 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 375 PCRDRKAYVFWDAYHTSDAANRVIADRLWAGMT 277 PC + V WD H + AAN+ I D++ G++ Sbjct: 334 PCDEPDKAVVWDGVHFTQAANKFIFDKIAPGLS 366
>EMBA_MYCSM (Q50394) Probable arabinosyltransferase A (EC 2.4.2.-)| Length = 1092 Score = 28.1 bits (61), Expect = 8.8 Identities = 17/33 (51%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -1 Query: 391 PAGLDAL-PRPQGVRVLGRVPHLRRRQPGHRRP 296 P GL AL P G R +GRV RR PG RP Sbjct: 422 PQGLIALAPLLVGARAIGRVVTARRAAPGSWRP 454 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,757,378 Number of Sequences: 219361 Number of extensions: 719408 Number of successful extensions: 1857 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1816 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1857 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)