Clone Name | rbart08g02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RK4_SPIOL (O49937) 50S ribosomal protein L4, chloroplast precurs... | 28 | 8.8 |
---|
>RK4_SPIOL (O49937) 50S ribosomal protein L4, chloroplast precursor (R-protein| L4) Length = 293 Score = 27.7 bits (60), Expect = 8.8 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 11 DTFYYLRFHKPTKLHNTLHKGLHTHKLGKRANT 109 +TF L+ P K +H+GL TH KR T Sbjct: 67 ETFLNLKTAPPEKARAVVHRGLITHLQNKRRGT 99 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,512,952 Number of Sequences: 219361 Number of extensions: 344596 Number of successful extensions: 628 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 80,573,946 effective HSP length: 34 effective length of database: 73,115,672 effective search space used: 1754776128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)