Clone Name | rbart08f08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MPRI_BOVIN (P08169) Cation-independent mannose-6-phosphate recep... | 30 | 4.2 | 2 | UVRC_CORDI (Q6NH31) UvrABC system protein C (Protein uvrC) (Exci... | 28 | 9.4 |
---|
>MPRI_BOVIN (P08169) Cation-independent mannose-6-phosphate receptor precursor| (CI Man-6-P receptor) (CI-MPR) (M6PR) (Insulin-like growth factor 2 receptor) (Insulin-like growth factor II receptor) (IGF-II receptor) (300 kDa mannose 6-phosphate receptor) Length = 2499 Score = 29.6 bits (65), Expect = 4.2 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 381 YTSGGPWFELYKDCEFADLW 322 +T+G P F+L DCE+ LW Sbjct: 1201 HTTGSPTFQLQNDCEYVFLW 1220
>UVRC_CORDI (Q6NH31) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 687 Score = 28.5 bits (62), Expect = 9.4 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +3 Query: 18 YWILGPQ--GTRLTGPYSYTWYSIVTLAVGTNLTTART 125 Y+ GPQ G R GPYS+ W TL + T + RT Sbjct: 118 YFYRGPQRKGVRYYGPYSHAWAVRETLDLLTRVFPIRT 155 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,217,177 Number of Sequences: 219361 Number of extensions: 919868 Number of successful extensions: 2181 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2181 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)