| Clone Name | rbart08e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PSA3_ORYSA (Q9LSU0) Proteasome subunit alpha type 3 (EC 3.4.25.1... | 37 | 0.023 | 2 | PSA3_ARATH (O23715) Proteasome subunit alpha type 3 (EC 3.4.25.1... | 34 | 0.25 | 3 | PSA3_SPIOL (O24362) Proteasome subunit alpha type 3 (EC 3.4.25.1... | 33 | 0.56 | 4 | OR4Q3_HUMAN (Q8NH05) Olfactory receptor 4Q3 (Olfactory receptor ... | 29 | 6.2 | 5 | Y231_BUCAP (Q8K9S5) Hypothetical protein BUsg231 precursor | 29 | 8.1 |
|---|
>PSA3_ORYSA (Q9LSU0) Proteasome subunit alpha type 3 (EC 3.4.25.1) (20S| proteasome alpha subunit G) (20S proteasome subunit alpha-7) Length = 249 Score = 37.4 bits (85), Expect = 0.023 Identities = 13/17 (76%), Positives = 17/17 (100%) Frame = -2 Query: 501 LSWVCEESNRQHEKVPS 451 LSW+C+ESNRQH+KVP+ Sbjct: 213 LSWICDESNRQHQKVPA 229
>PSA3_ARATH (O23715) Proteasome subunit alpha type 3 (EC 3.4.25.1) (Proteasome| subunit alpha type 7) (20S proteasome alpha subunit G-1) (Proteasome component 8) (DiDi 17A-2a) Length = 249 Score = 33.9 bits (76), Expect = 0.25 Identities = 11/16 (68%), Positives = 15/16 (93%) Frame = -2 Query: 501 LSWVCEESNRQHEKVP 454 +SW+CEES R+H+KVP Sbjct: 213 MSWICEESKREHQKVP 228
>PSA3_SPIOL (O24362) Proteasome subunit alpha type 3 (EC 3.4.25.1) (20S| proteasome alpha subunit G) (20S proteasome subunit alpha-7) (Proteasome component C8) Length = 249 Score = 32.7 bits (73), Expect = 0.56 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = -2 Query: 501 LSWVCEESNRQHEKVP 454 +SW+C+ES R+H+KVP Sbjct: 213 MSWICDESKREHQKVP 228
>OR4Q3_HUMAN (Q8NH05) Olfactory receptor 4Q3 (Olfactory receptor OR14-3)| Length = 313 Score = 29.3 bits (64), Expect = 6.2 Identities = 15/43 (34%), Positives = 27/43 (62%) Frame = -2 Query: 273 IPVEVLANRSVLSLLCWLHLIFY*ILSDLKNLSLIYLSLRCHY 145 + V V+AN +LSL+C+L L+F + ++I ++LR H+ Sbjct: 196 VEVLVIANSGLLSLVCFLVLLF--------SYAIILITLRTHF 230
>Y231_BUCAP (Q8K9S5) Hypothetical protein BUsg231 precursor| Length = 799 Score = 28.9 bits (63), Expect = 8.1 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 4/62 (6%) Frame = -2 Query: 192 DLKNLSLIYLSLRCHYSNLRARGMR----ENRHRTCVYPKFSIQPEINDSIILGSLYFLY 25 DLKNLS YL+ +Y N+ + +R +N+ VY + +I++ + G+L Y Sbjct: 222 DLKNLSNFYLNQGYYYFNIHRKKVRFLKDKNKVNITVYISEGKKYKISNFFLNGNLLQYY 281 Query: 24 KS 19 +S Sbjct: 282 QS 283 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,575,820 Number of Sequences: 219361 Number of extensions: 864695 Number of successful extensions: 1825 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1797 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1825 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)