| Clone Name | rbart08e04 |
|---|---|
| Clone Library Name | barley_pub |
>PER40_ARATH (O23474) Peroxidase 40 precursor (EC 1.11.1.7) (Atperox P40)| Length = 348 Score = 35.8 bits (81), Expect = 0.058 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -1 Query: 474 LVHKWANDKDDFFRKFSDAMAKMARLPVSGRTEFRDNC 361 +V +A D+ FF F +AM KM +P +E R NC Sbjct: 307 IVETYATDQSVFFEDFKNAMVKMGGIPGGSNSEIRKNC 344
>PER22_ARATH (P24102) Peroxidase 22 precursor (EC 1.11.1.7) (Atperox P22)| (ATPEa) (Basic peroxidase E) Length = 349 Score = 33.9 bits (76), Expect = 0.22 Identities = 18/40 (45%), Positives = 27/40 (67%), Gaps = 2/40 (5%) Frame = -1 Query: 474 LVHKWANDKDDFFRKFSDAMAKMARL-PVSG-RTEFRDNC 361 LV+++++D FFR F DAM +M L P++G + E R NC Sbjct: 290 LVNQYSSDMSVFFRAFIDAMIRMGNLRPLTGTQGEIRQNC 329
>PER17_ARATH (Q9SJZ2) Peroxidase 17 precursor (EC 1.11.1.7) (Atperox P17)| (ATP25a) Length = 329 Score = 32.0 bits (71), Expect = 0.83 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 471 VHKWANDKDDFFRKFSDAMAKMARLPVSGRTEFRDNC 361 V ++ D+D+FFR F++ M K+ L E R NC Sbjct: 279 VKMFSEDQDEFFRAFAEGMVKLGDLQSGRPGEIRFNC 315
>CCPR_ASPFU (Q4WPF8) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 366 Score = 30.8 bits (68), Expect = 1.9 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = -1 Query: 471 VHKWANDKDDFFRKFSDAMAKMARL--PVSGRTEFR 370 V ++A D D FF+ FSDA K+ L P + + E R Sbjct: 324 VERYARDSDAFFKDFSDAFVKLLELGVPFTSKAEDR 359
>CCPR_EMENI (P0C0V3) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 361 Score = 30.0 bits (66), Expect = 3.2 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -1 Query: 471 VHKWANDKDDFFRKFSDAMAKMARLPVSGRTEFRDNCFRRKS 346 V ++A D D FF++FS+ K+ L V ++ D ++S Sbjct: 319 VERYAKDSDAFFKEFSEVFVKLLELGVPFNSKVEDRYVFKRS 360
>GDA1_ASPFU (Q8TGG8) Probable guanosine-diphosphatase (EC 3.6.1.42) (GDPase)| Length = 503 Score = 30.0 bits (66), Expect = 3.2 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +1 Query: 343 HRLAPEAVVTELGSSAHGQTGHLCHGVAE--LPKEIILVVSP 462 H+LAPE VT +G G T C G+AE L KE ++P Sbjct: 327 HKLAPEVQVTMVGPKV-GSTAAQCRGLAEKTLNKEAACTLAP 367
>YDFJ_BACSU (P96687) Membrane protein ydfJ| Length = 724 Score = 29.6 bits (65), Expect = 4.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -1 Query: 321 AEGFAASA*EIYGMDHPTSTTSAMP 247 AE FA + EI G+DH S T AMP Sbjct: 429 AEAFADAVKEIKGLDHVASVTPAMP 453
>MRP1_RAT (Q8CG09) Multidrug resistance-associated protein 1 (ATP-binding| cassette sub-family C member 1) (Leukotriene C(4) transporter) (LTC4 transporter) Length = 1532 Score = 29.3 bits (64), Expect = 5.4 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 4/32 (12%) Frame = -1 Query: 396 PVSGRTEFRDNCFRRKS----MRETVNVTAEG 313 P SGR EFRD C R + + + +NVT EG Sbjct: 1289 PHSGRVEFRDYCLRYREDLDLVLKHINVTIEG 1320
>TNI3K_HUMAN (Q59H18) Serine/threonine-protein kinase TNNI3K (EC 2.7.11.1)| (TNNI3-interacting kinase) (Cardiac ankyrin repeat kinase) Length = 936 Score = 29.3 bits (64), Expect = 5.4 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +2 Query: 347 DLRLKQLSRNSVLPLTGKRAIFAMASLNFRKKSSLSLAHL 466 DL++K+ + + G F+ +LN+R ++ LSL HL Sbjct: 135 DLQIKEKELTELRNIFGSDEAFSKVNLNYRTENGLSLLHL 174
>MRP1_MOUSE (O35379) Multidrug resistance-associated protein 1 (ATP-binding| cassette sub-family C member 1) (Leukotriene C(4) transporter) (LTC4 transporter) Length = 1528 Score = 29.3 bits (64), Expect = 5.4 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 4/32 (12%) Frame = -1 Query: 396 PVSGRTEFRDNCFRRKS----MRETVNVTAEG 313 P SGR EFRD C R + + + +NVT EG Sbjct: 1285 PHSGRVEFRDYCLRYREDLDLVLKHINVTIEG 1316
>CCPR2_GIBZE (Q4HWQ2) Putative heme-binding peroxidase (EC 1.11.1.-)| Length = 331 Score = 28.9 bits (63), Expect = 7.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -1 Query: 471 VHKWANDKDDFFRKFSDAMAKMARLPVSGRTE 376 V +A DKD FF+ F A AK+ L ++ +E Sbjct: 253 VQLYAKDKDVFFQDFKKAFAKLLELGIARNSE 284
>PERE5_ARMRU (P59121) Peroxidase E5 (EC 1.11.1.7)| Length = 306 Score = 28.9 bits (63), Expect = 7.1 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = -1 Query: 474 LVHKWANDKDDFFRKFSDAMAKMARL-PVSG-RTEFRDNC 361 LV+ ++++ FF F+DAM +M L P++G + E R NC Sbjct: 261 LVNLYSSNTLSFFGAFADAMIRMGNLRPLTGTQGEIRQNC 300
>CCPR_YEAST (P00431) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 361 Score = 28.5 bits (62), Expect = 9.2 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 Query: 474 LVHKWANDKDDFFRKFSDAMAKM 406 +V ++AND+D FF+ FS A K+ Sbjct: 314 IVKEYANDQDKFFKDFSKAFEKL 336
>TNI3K_MOUSE (Q5GIG6) Serine/threonine-protein kinase TNNI3K (EC 2.7.11.1)| (TNNI3-interacting kinase) (Cardiac ankyrin repeat kinase) Length = 833 Score = 28.5 bits (62), Expect = 9.2 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 347 DLRLKQLSRNSVLPLTGKRAIFAMASLNFRKKSSLSLAHL 466 DL++K+ + + G F+ SLN+R + LSL HL Sbjct: 33 DLQIKENEFQELRHIFGSDEAFSEVSLNYRTERGLSLLHL 72
>CEP72_HUMAN (Q9P209) Centrosomal protein of 72 kDa (Cep72 protein)| Length = 647 Score = 28.5 bits (62), Expect = 9.2 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +2 Query: 335 VSLIDLRLKQLSRNSVLPLTGKRAIFAMASLNFRKKSSLSLAHLW 469 +SL L+ LSRNS++ L G + + A+ SLN SLA ++ Sbjct: 51 MSLTGLKSLDLSRNSLVSLEGIQYLTALESLNLYYNCISSLAEVF 95 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,231,707 Number of Sequences: 219361 Number of extensions: 1197979 Number of successful extensions: 2884 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 2837 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2884 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)