| Clone Name | rbart08d12 |
|---|---|
| Clone Library Name | barley_pub |
>STA5A_SHEEP (P42231) Signal transducer and activator of transcription 5A| (Mammary gland factor) Length = 794 Score = 32.0 bits (71), Expect = 0.37 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +1 Query: 1 QRYQCSFQESN-RTVQLIHTNQT*ILCSPPISWNQSHTWSLLEQTRRS 141 Q+Y+ E + +T+QL+ QT IL I W + H W +E RS Sbjct: 224 QQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRHDWRGMEAPPRS 271
>CBIO1_MYCMS (Q6MSQ2) Cobalt import ATP-binding protein cbiO 1| Length = 303 Score = 29.3 bits (64), Expect = 2.4 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -2 Query: 130 FVPRETTCVIGSTRSGVST--EFTSGLCVS 47 F + TCVIG+T SG ST + T+GL +S Sbjct: 48 FKKNKVTCVIGTTGSGKSTMIQLTNGLIIS 77
>RELA_STRAT (O85709) GTP pyrophosphokinase (EC 2.7.6.5) (ATP:GTP| 3'-pyrophosphotransferase) (ppGpp synthetase I) ((P)ppGpp synthetase) Length = 841 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 Query: 393 AHAGDGGARVPGEDDLPAELRARQVRPGGAP 301 AHA DGG V + PA+ A + RP AP Sbjct: 25 AHAQDGGGPVEHDRSAPADKPAERTRPKPAP 55
>CCPR_YARLI (Q6C0Z6) Cytochrome c peroxidase, mitochondrial precursor (EC| 1.11.1.5) (CCP) Length = 340 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 84 PDLVEPITHVVSLGTNQTFNNQQHVALYGTRLL 182 PD + THV ++ Q FN+Q+ VAL G L Sbjct: 194 PDASQGATHVRNVFNRQGFNDQEMVALIGAHAL 226
>CBIO2_MESFL (Q6F1W4) Cobalt import ATP-binding protein cbiO 2| Length = 315 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/27 (51%), Positives = 20/27 (74%), Gaps = 2/27 (7%) Frame = -2 Query: 121 RETTCVIGSTRSGVST--EFTSGLCVS 47 ++ TCVIG+T SG ST + T+GL +S Sbjct: 61 KKITCVIGTTGSGKSTMIQLTNGLLIS 87
>ENV_HV2RO (P04577) Envelope polyprotein GP160 precursor [Contains: Exterior| membrane glycoprotein (GP120); Transmembrane glycoprotein (GP41)] Length = 858 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 56 QTRREFCAHPRSRGTNHTRGLSWNKP 133 + + HPR RGTN TR +S+ P Sbjct: 352 EVKETLAKHPRYRGTNDTRNISFAAP 377
>CBIO2_SPIKU (Q6XYZ3) Cobalt import ATP-binding protein cbiO 2| Length = 305 Score = 28.5 bits (62), Expect = 4.0 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -2 Query: 181 SSLVPYRATCC*LLNVWFVPRETTCVIGSTRSGVST 74 S PY T +NV P + T +IGST SG ST Sbjct: 28 SPKTPYEYTSLQDINVVIKPGKITAIIGSTGSGKST 63
>ENV_HV2G1 (P18040) Envelope polyprotein GP160 precursor [Contains: Exterior| membrane glycoprotein (GP120); Transmembrane glycoprotein (GP41)] Length = 851 Score = 28.1 bits (61), Expect = 5.3 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +2 Query: 56 QTRREFCAHPRSRGTNHTRGLSWNKP 133 + ++ HPR +GTN T+ +++ KP Sbjct: 341 EVKQTLIKHPRYKGTNDTKNINFTKP 366
>EXUT_BACSU (O34456) Hexuronate transporter| Length = 422 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 169 PYRATCC*LLNVWFVPRETTCVIGSTRSG 83 P AT ++N WF P + VIG T SG Sbjct: 112 PLSATINKMVNNWFPPTQRASVIGVTNSG 140 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,021,116 Number of Sequences: 219361 Number of extensions: 696233 Number of successful extensions: 2004 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2004 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)