Clone Name | rbart08d02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LAS17_YEAST (Q12446) Proline-rich protein LAS17 | 31 | 0.93 | 2 | CYTSA_TETNG (Q2KN95) Cytospin-A | 28 | 4.6 | 3 | YQ5C_CAEEL (Q09466) Putative ABC transporter C16C10.12 in chromo... | 28 | 6.0 | 4 | CYTSA_FUGRU (Q2KN94) Cytospin-A | 28 | 7.9 |
---|
>LAS17_YEAST (Q12446) Proline-rich protein LAS17| Length = 633 Score = 30.8 bits (68), Expect = 0.93 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +3 Query: 165 HTPRRDGXFENY---YXVRGRDTIHVRAHQXPPPPPHDRSTIN 284 H PR + +N Y DTI H+ PPPPP T + Sbjct: 154 HGPRGESLIDNQRKRYNYEDVDTIPTTKHKAPPPPPPTAETFD 196
>CYTSA_TETNG (Q2KN95) Cytospin-A| Length = 1113 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 142 FKSASFSQYSTCCTTFPTXCIVPVPRTPFNPA 47 F SAS S+ + PT P+PRTP +P+ Sbjct: 832 FDSASQGPPSSGASVTPTASAAPLPRTPLSPS 863
>YQ5C_CAEEL (Q09466) Putative ABC transporter C16C10.12 in chromosome III| Length = 610 Score = 28.1 bits (61), Expect = 6.0 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 26 NNLHTYARWIKWRAWYWYNAXG 91 NN Y RW++W +W Y G Sbjct: 526 NNFPVYIRWMQWTSWCRYGFEG 547
>CYTSA_FUGRU (Q2KN94) Cytospin-A| Length = 1118 Score = 27.7 bits (60), Expect = 7.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 142 FKSASFSQYSTCCTTFPTXCIVPVPRTPFNPA 47 F SAS S + PT P+PRTP +P+ Sbjct: 837 FDSASQGPPSNGASVTPTVSAAPLPRTPLSPS 868 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,260,803 Number of Sequences: 219361 Number of extensions: 669542 Number of successful extensions: 1975 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1889 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1966 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)