ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart08c03 |
|---|---|
| Clone Library Name | barley_pub |
>TTP_RAT (P47973) Tristetraproline (TTP) (Zinc finger protein 36) (Zfp-36)| (TIS11A protein) (TIS11) Length = 320 Score = 33.1 bits (74), Expect = 0.27 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 418 FLKGTCTFGERCHFAHGETE 359 +L+G C +G RCHF H TE Sbjct: 144 YLQGRCPYGSRCHFIHNPTE 163 Score = 28.5 bits (62), Expect = 6.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 409 GTCTFGERCHFAHGETEQRK 350 G C +G +C FAHG E R+ Sbjct: 109 GRCRYGAKCQFAHGPGELRQ 128
>TTP_MOUSE (P22893) Tristetraproline (TTP) (Zinc finger protein 36) (Zfp-36)| (TIS11A protein) (TIS11) (Growth factor-inducible nuclear protein NUP475) (TPA-induced sequence 11) Length = 319 Score = 33.1 bits (74), Expect = 0.27 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 418 FLKGTCTFGERCHFAHGETE 359 +L+G C +G RCHF H TE Sbjct: 143 YLQGRCPYGSRCHFIHNPTE 162
>TISD_HUMAN (P47974) Butyrate response factor 2 (TIS11D protein) (EGF-response| factor 2) (ERF-2) Length = 492 Score = 32.0 bits (71), Expect = 0.61 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 Query: 409 GTCTFGERCHFAHGETEQR 353 GTC +GE+C FAHG E R Sbjct: 166 GTCKYGEKCQFAHGFHELR 184 Score = 29.3 bits (64), Expect = 3.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 409 GTCTFGERCHFAHGETEQR 353 G C +G RCHF H E+R Sbjct: 204 GFCPYGPRCHFIHNADERR 222
>TISD_MOUSE (P23949) Butyrate response factor 2 (TIS11D protein)| Length = 367 Score = 32.0 bits (71), Expect = 0.61 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 Query: 409 GTCTFGERCHFAHGETEQR 353 GTC +GE+C FAHG E R Sbjct: 139 GTCKYGEKCQFAHGFHELR 157 Score = 29.3 bits (64), Expect = 3.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 409 GTCTFGERCHFAHGETEQR 353 G C +G RCHF H E+R Sbjct: 177 GFCPYGPRCHFIHNADERR 195
>ZFS1_SCHPO (P47979) Zinc-finger protein zfs1| Length = 404 Score = 31.6 bits (70), Expect = 0.79 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 415 LKGTCTFGERCHFAHGETEQRK 350 + GTC +G +C FAHG E ++ Sbjct: 337 ISGTCRYGSKCQFAHGNQELKE 358
>TTP_SHEEP (Q6S9E0) Tristetraproline (TTP) (Zinc finger protein 36 homolog)| (Zfp-36) Length = 325 Score = 31.6 bits (70), Expect = 0.79 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 418 FLKGTCTFGERCHFAHGETE 359 +L+G C +G RCHF H +E Sbjct: 149 YLQGRCPYGSRCHFIHNPSE 168
>TTP_HUMAN (P26651) Tristetraproline (TTP) (Zinc finger protein 36 homolog)| (Zfp-36) (TIS11A protein) (TIS11) (Growth factor-inducible nuclear protein NUP475) (G0/G1 switch regulatory protein 24) Length = 326 Score = 31.6 bits (70), Expect = 0.79 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 418 FLKGTCTFGERCHFAHGETE 359 +L+G C +G RCHF H +E Sbjct: 151 YLQGRCPYGSRCHFIHNPSE 170
>TTP_BOVIN (P53781) Tristetraproline (TTP) (Zinc finger protein 36 homolog)| (Zfp-36) (TIS11A protein) (TIS11) Length = 324 Score = 31.6 bits (70), Expect = 0.79 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 418 FLKGTCTFGERCHFAHGETE 359 +L+G C +G RCHF H +E Sbjct: 149 YLQGRCPYGSRCHFIHNPSE 168 Score = 28.1 bits (61), Expect = 8.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 409 GTCTFGERCHFAHGETEQRKGA 344 G C +G +C FAHG E R+ + Sbjct: 114 GRCRYGAKCQFAHGLGELRQAS 135
>CTH2_YEAST (P47977) Zinc finger protein CTH2 (YTIS11 protein)| Length = 285 Score = 30.8 bits (68), Expect = 1.4 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 415 LKGTCTFGERCHFAHG 368 LKG+C +G +C FAHG Sbjct: 180 LKGSCPYGSKCQFAHG 195
>TIS1_DROME (P47980) Protein TIS11 (dTIS11)| Length = 436 Score = 30.8 bits (68), Expect = 1.4 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 Query: 409 GTCTFGERCHFAHGETEQR 353 G C +GE+C FAHG E R Sbjct: 148 GECKYGEKCQFAHGSHELR 166 Score = 28.9 bits (63), Expect = 5.1 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -3 Query: 409 GTCTFGERCHFAHGETEQR 353 G C +G RCHF H E R Sbjct: 186 GFCPYGPRCHFVHNADEAR 204
>ZGPAT_MOUSE (Q8VDM1) Zinc finger CCCH-type with G patch domain protein| Length = 511 Score = 29.6 bits (65), Expect = 3.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 418 FLKGTCTFGERCHFAHGE 365 FL+G C F E C F+HG+ Sbjct: 182 FLEGKCRFKENCRFSHGQ 199
>PIE1_CAEEL (Q94131) Pharynx and intestine in excess protein 1 (Protein pie-1)| Length = 335 Score = 29.6 bits (65), Expect = 3.0 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 421 NFLKGTCTFGERCHFAHGETEQRKGA 344 NF +G C +G RC F H E Q A Sbjct: 192 NFERGNCRYGPRCRFIHVEQMQHFNA 217
>ZGPAT_HUMAN (Q8N5A5) Zinc finger CCCH-type with G patch domain protein (Zinc| finger CCCH-type domain-containing protein 9) Length = 531 Score = 29.6 bits (65), Expect = 3.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 418 FLKGTCTFGERCHFAHGE 365 FL+G C F E C F+HG+ Sbjct: 183 FLEGKCRFKENCRFSHGQ 200
>CTH1_YEAST (P47976) Zinc finger protein CTH1| Length = 325 Score = 29.6 bits (65), Expect = 3.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 415 LKGTCTFGERCHFAHGETE 359 +KG C +G +C FAHG E Sbjct: 215 IKGYCKYGNKCQFAHGLNE 233
>VSG4_TRYBR (P02897) Variant surface glycoprotein 4 precursor (VSG 4)| (Metacyclic variable antigen) (Fragment) Length = 476 Score = 29.6 bits (65), Expect = 3.0 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 261 TARENRIVTVAAQEGAEDPPQQRCHQTAAPFRCSVSPWAKWQ 386 + E + T A EGA D +++C P C+ +P KW+ Sbjct: 411 SGEEQKTQTTGAGEGAADKKEEKCKGKLEP-ECTKAPECKWE 451
>CRTY_PANAN (P21687) Lycopene cyclase| Length = 382 Score = 29.6 bits (65), Expect = 3.0 Identities = 24/81 (29%), Positives = 32/81 (39%) Frame = +3 Query: 153 TLQSQQERPEAYSIRKS*I*ITIHGTKYNRPNHLEPTARENRIVTVAAQEGAEDPPQQRC 332 T+ Q YS+ S + I T Y L+P I AAQ+G + R Sbjct: 176 TVDQQNGYRFVYSLPLSPTRLLIEDTHYIDNATLDPECARQNICDYAAQQGWQLQTLLRE 235 Query: 333 HQTAAPFRCSVSPWAKWQRSP 395 Q A P S + A WQ+ P Sbjct: 236 EQGALPITLSGNADAFWQQRP 256
>YQC1_SCHPO (O74463) Hypothetical protein C1739.01 in chromosome III| Length = 547 Score = 29.3 bits (64), Expect = 3.9 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -3 Query: 418 FLKGTCTFGERCHFAHG-ETEQ 356 F GTCT GE C F+H ETE+ Sbjct: 50 FRNGTCTAGENCPFSHSLETER 71
>TISB_RAT (P17431) Butyrate response factor 1 (TIS11B protein) (EGF-inducible| protein CMG1) Length = 338 Score = 29.3 bits (64), Expect = 3.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 409 GTCTFGERCHFAHGETEQR 353 G C +G RCHF H E+R Sbjct: 165 GFCPYGPRCHFIHNAEERR 183 Score = 28.9 bits (63), Expect = 5.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 409 GTCTFGERCHFAHGETEQR 353 G C +G++C FAHG E R Sbjct: 127 GACKYGDKCQFAHGIHELR 145
>TISB_MOUSE (P23950) Butyrate response factor 1 (TIS11B protein)| Length = 338 Score = 29.3 bits (64), Expect = 3.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 409 GTCTFGERCHFAHGETEQR 353 G C +G RCHF H E+R Sbjct: 165 GFCPYGPRCHFIHNAEERR 183 Score = 28.9 bits (63), Expect = 5.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 409 GTCTFGERCHFAHGETEQR 353 G C +G++C FAHG E R Sbjct: 127 GACKYGDKCQFAHGIHELR 145
>TISB_HUMAN (Q07352) Butyrate response factor 1 (TIS11B protein) (EGF-response| factor 1) (ERF-1) Length = 338 Score = 29.3 bits (64), Expect = 3.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 409 GTCTFGERCHFAHGETEQR 353 G C +G RCHF H E+R Sbjct: 165 GFCPYGPRCHFIHNAEERR 183 Score = 28.9 bits (63), Expect = 5.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 409 GTCTFGERCHFAHGETEQR 353 G C +G++C FAHG E R Sbjct: 127 GACKYGDKCQFAHGIHELR 145
>K0853_HUMAN (Q5T200) Protein KIAA0853| Length = 1668 Score = 29.3 bits (64), Expect = 3.9 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -3 Query: 421 NFLK-GTCTFGERCHFAHGETEQRKG 347 N+LK G C +G C F HG + + KG Sbjct: 44 NWLKTGNCLYGNTCRFVHGPSPRGKG 69
>CO8B_RABIT (P98137) Complement component C8 beta chain precursor (Complement| component 8 beta subunit) Length = 590 Score = 28.9 bits (63), Expect = 5.1 Identities = 16/57 (28%), Positives = 25/57 (43%) Frame = +3 Query: 213 ITIHGTKYNRPNHLEPTARENRIVTVAAQEGAEDPPQQRCHQTAAPFRCSVSPWAKW 383 + + G++ RP LEPT NR + + + D T P C +S W+ W Sbjct: 25 LCVPGSRSERPRSLEPTV-VNRSLAKSRHSRSVDA-------TPMPIDCELSSWSSW 73
>Z3H7A_HUMAN (Q8IWR0) Zinc finger CCCH-type domain-containing protein 7A| Length = 971 Score = 28.9 bits (63), Expect = 5.1 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 418 FLKGTCTFGERCHFAHGETE 359 ++ GTC G C FAHG E Sbjct: 910 YMNGTCPEGNSCKFAHGNAE 929
>DHX57_HUMAN (Q6P158) Putative ATP-dependent RNA helicase DHX57 (EC 3.6.1.-)| (DEAH box protein 57) Length = 1386 Score = 28.5 bits (62), Expect = 6.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 418 FLKGTCTFGERCHFAH 371 +LKG C FG +C F H Sbjct: 308 YLKGNCKFGSKCRFKH 323
>VIV1_MAIZE (P26307) Regulatory protein viviparous-1| Length = 691 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 375 PMARPNSGRVPPSDDTAAAVDPQ 307 P+++ NS R PPS AAA PQ Sbjct: 458 PLSKSNSSRAPPSSLEAAAAAPQ 480
>DHX57_MOUSE (Q6P5D3) Putative ATP-dependent RNA helicase DHX57 (EC 3.6.1.-)| (DEAH box protein 57) Length = 1388 Score = 28.1 bits (61), Expect = 8.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 418 FLKGTCTFGERCHFAH 371 +LKG C FG +C F H Sbjct: 308 YLKGNCKFGSKCKFKH 323
>CS007_MOUSE (Q6ZPZ3) Zinc finger CCCH-type domain-containing protein C19orf7| homolog Length = 1304 Score = 28.1 bits (61), Expect = 8.8 Identities = 8/16 (50%), Positives = 14/16 (87%) Frame = -3 Query: 418 FLKGTCTFGERCHFAH 371 F++G CT+G+ C+F+H Sbjct: 398 FVEGRCTWGDHCNFSH 413
>RN113_CAEEL (O17917) Putative RING finger protein 113 homolog| Length = 384 Score = 28.1 bits (61), Expect = 8.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 409 GTCTFGERCHFAHGETEQRKG 347 G CTFG+ C F H ++ + G Sbjct: 188 GFCTFGDSCKFVHDRSDYKHG 208
>CS007_HUMAN (Q9UPT8) Zinc finger CCCH-type domain-containing protein C19orf7| Length = 1303 Score = 28.1 bits (61), Expect = 8.8 Identities = 8/16 (50%), Positives = 14/16 (87%) Frame = -3 Query: 418 FLKGTCTFGERCHFAH 371 F++G CT+G+ C+F+H Sbjct: 399 FVEGRCTWGDHCNFSH 414 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,412,102 Number of Sequences: 219361 Number of extensions: 998295 Number of successful extensions: 3169 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 2999 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3168 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
