Clone Name | rbart08b11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VP39_NPVOP (P17500) Major capsid protein | 32 | 0.87 | 2 | ZN462_HUMAN (Q96JM2) Zinc finger protein 462 | 28 | 9.6 |
---|
>VP39_NPVOP (P17500) Major capsid protein| Length = 351 Score = 32.0 bits (71), Expect = 0.87 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = +2 Query: 152 EDMHTRTCSTCTINRTGLWALDDHCKLL*VAIDDQHMPIGNPSIIKPNDQEL 307 ED+ R C+TC IN TGL A + +L + P+ + IIK L Sbjct: 222 EDLRLRNCNTCVINNTGLVATVTNTEL--------YNPVRSSDIIKTRPNRL 265
>ZN462_HUMAN (Q96JM2) Zinc finger protein 462| Length = 1412 Score = 28.5 bits (62), Expect = 9.6 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = +2 Query: 122 EPNPPRLLIMEDMHTRTCSTCTINRTGLWALDDH 223 +P+PP L + + T C C +W + +H Sbjct: 199 DPSPPSLTMPAEAKTYRCRDCVFEAVSIWDITNH 232 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,930,329 Number of Sequences: 219361 Number of extensions: 1299629 Number of successful extensions: 3096 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2985 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3096 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)