Clone Name | rbart07f04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BSC2_YEAST (Q05611) Bypass of stop codon protein 2 | 31 | 2.1 | 2 | LAP1_DROME (Q9V780) Protein lap1 | 30 | 2.7 | 3 | GLND_PASMU (Q9CNH1) [Protein-PII] uridylyltransferase (EC 2.7.7.... | 29 | 7.9 | 4 | SRA34_CAEEL (Q10936) Serpentine receptor class alpha-34 (Protein... | 29 | 7.9 |
---|
>BSC2_YEAST (Q05611) Bypass of stop codon protein 2| Length = 235 Score = 30.8 bits (68), Expect = 2.1 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 6/54 (11%) Frame = -2 Query: 172 RILSL*WHCAYTKE---GL-VMY*I--LLCFINVISVLYTHLILSMRDCFDVLC 29 ++LSL WHC E GL +M+ I L+C + VI +L +IL D F +C Sbjct: 46 KVLSLTWHCGILSEIRSGLMLMFGIFQLMCSLGVIVLLLPIIILDAIDLFLYMC 99
>LAP1_DROME (Q9V780) Protein lap1| Length = 849 Score = 30.4 bits (67), Expect = 2.7 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -1 Query: 332 TLFMLPLPLTRLNDRPEVHPVMNVYVFMYALQRAQHENSGGRLCVA 195 T FMLP ++N Y F+YA Q+ H + R+C A Sbjct: 415 TCFMLPQVTFKMNSIQAQQQAQEQYEFVYANQQQPHASPSRRICFA 460
>GLND_PASMU (Q9CNH1) [Protein-PII] uridylyltransferase (EC 2.7.7.59) (PII| uridylyl-transferase) (Uridylyl-removing enzyme) (UTase) Length = 864 Score = 28.9 bits (63), Expect = 7.9 Identities = 18/69 (26%), Positives = 28/69 (40%) Frame = +3 Query: 231 RSLQGIHKYIYIHNWMDLRSIVKACERQWQHEQGCSTLDKFSCVECPRLCHATTIXVDLP 410 R+L +HKY ++KA QW H +G D F C H + L Sbjct: 411 RALVPMHKY----------GVLKAYLPQWHHIEGLMQFDLFHCYTVDE--HIVRTLLKLE 458 Query: 411 YMVSSSNIV 437 Y + + ++V Sbjct: 459 YFLEAESVV 467
>SRA34_CAEEL (Q10936) Serpentine receptor class alpha-34 (Protein sra-34)| Length = 355 Score = 28.9 bits (63), Expect = 7.9 Identities = 27/115 (23%), Positives = 58/115 (50%), Gaps = 14/115 (12%) Frame = +3 Query: 165 SILIYSMLESCNTKPSSTILML---RSLQGIHKYIY--IHNWMDLRSIVKACERQWQHEQ 329 ++++ L + + P+ST+++L ++ IH+++Y I NW LRS+V W +Q Sbjct: 43 TVVVLRKLYTKSIFPNSTLVLLVASLAVGSIHEFLYGFIQNWSLLRSLV-----YW--DQ 95 Query: 330 GCSTL-DKFSC-------VECPRLCHATTIXVDLPYMVSSSNI-VESTSPRANAL 467 C + +++ C + L T + + +++ SN+ ++ST+ R L Sbjct: 96 PCKIMFNEYECYPFYTANIFIRLLMICTNCAITIDRLITLSNVGIKSTAQRGIVL 150 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,864,357 Number of Sequences: 219361 Number of extensions: 1455599 Number of successful extensions: 3575 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3575 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)