| Clone Name | rbart07f03 |
|---|---|
| Clone Library Name | barley_pub |
>PRS4_ORYSA (P46466) 26S protease regulatory subunit 4 homolog (TAT-binding| protein homolog 2) Length = 448 Score = 46.2 bits (108), Expect = 2e-05 Identities = 24/36 (66%), Positives = 24/36 (66%) Frame = -1 Query: 218 LAXRERRMKVTHADFXXXXXXXXXXXKEGVPEGLYM 111 LA RERRMKVTHADF KEGVPEGLYM Sbjct: 413 LALRERRMKVTHADFKKAKEKVMFKKKEGVPEGLYM 448
>PRS4_CHICK (Q90732) 26S protease regulatory subunit 4 (P26s4) (Proteasome 26S| subunit ATPase 1) Length = 440 Score = 38.5 bits (88), Expect = 0.005 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = -1 Query: 218 LAXRERRMKVTHADFXXXXXXXXXXXKEGVPEGLYM 111 +A RERRMKVT+ DF EG PEGLY+ Sbjct: 405 MALRERRMKVTNEDFKKSKENFLYKKTEGTPEGLYL 440
>PRS4_DROME (P48601) 26S protease regulatory subunit 4 (P26s4)| Length = 439 Score = 38.5 bits (88), Expect = 0.005 Identities = 19/36 (52%), Positives = 22/36 (61%) Frame = -1 Query: 218 LAXRERRMKVTHADFXXXXXXXXXXXKEGVPEGLYM 111 +A RERRMKVT+ DF KEG PEGLY+ Sbjct: 404 MALRERRMKVTNEDFKKSKESVLYRKKEGTPEGLYL 439
>PRS4_RAT (P62193) 26S protease regulatory subunit 4 (P26s4) (Proteasome 26S| subunit ATPase 1) Length = 440 Score = 38.1 bits (87), Expect = 0.006 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = -1 Query: 218 LAXRERRMKVTHADFXXXXXXXXXXXKEGVPEGLYM 111 +A RERRMKVT+ DF +EG PEGLY+ Sbjct: 405 MALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL 440
>PRS4_MOUSE (P62192) 26S protease regulatory subunit 4 (P26s4) (Proteasome 26S| subunit ATPase 1) Length = 440 Score = 38.1 bits (87), Expect = 0.006 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = -1 Query: 218 LAXRERRMKVTHADFXXXXXXXXXXXKEGVPEGLYM 111 +A RERRMKVT+ DF +EG PEGLY+ Sbjct: 405 MALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL 440
>PRS4_HUMAN (P62191) 26S protease regulatory subunit 4 (P26s4) (Proteasome 26S| subunit ATPase 1) Length = 440 Score = 38.1 bits (87), Expect = 0.006 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = -1 Query: 218 LAXRERRMKVTHADFXXXXXXXXXXXKEGVPEGLYM 111 +A RERRMKVT+ DF +EG PEGLY+ Sbjct: 405 MALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL 440
>PRS4_CAEEL (O16368) Probable 26S protease regulatory subunit 4| Length = 443 Score = 33.5 bits (75), Expect = 0.15 Identities = 18/36 (50%), Positives = 20/36 (55%) Frame = -1 Query: 218 LAXRERRMKVTHADFXXXXXXXXXXXKEGVPEGLYM 111 LA RERRM+VT DF KEG PE LY+ Sbjct: 408 LALRERRMRVTMEDFQKSKENVLYRKKEGAPEELYL 443
>CHCB1_BOMMO (P08830) Chorion class CB protein M5H4 precursor| Length = 174 Score = 30.4 bits (67), Expect = 1.3 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 4/45 (8%) Frame = -3 Query: 126 GGALHVLNCAPVFTTRTTLRSDNI----LGIVGYIPWLGG*AQIG 4 GGAL V + +P T T+ S+N LGI G +P+LG A G Sbjct: 74 GGALAVNSLSPTTPTGLTVASENTIEGNLGIFGQLPFLGAVATDG 118
>PMP1_SCHPO (O13453) Tyrosine-protein phosphatase pmp1 (EC 3.1.3.48)| Length = 278 Score = 30.0 bits (66), Expect = 1.7 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = +2 Query: 5 PICAYPPNQGIY--PTIPNILSLRNVVLVVK 91 P+C YPPN +Y PT+P I S V+ V K Sbjct: 61 PVCIYPPNIYLYAKPTMPIIQSFDVVINVAK 91
>CLC6A_MOUSE (Q9JKF4) C-type lectin domain family 6 member A (C-type lectin| superfamily member 10) (Dendritic cell-associated lectin 2) (DC-associated C-type lectin-2) (DECTIN-2) Length = 209 Score = 29.3 bits (64), Expect = 2.9 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -1 Query: 98 HRSSLPEQHCVVIIYW--VSWDIFPGWAD 18 H +LPE+ CV I+YW W GW D Sbjct: 167 HEPNLPEERCVSIVYWNPSKW----GWND 191
>PRS4_YEAST (P40327) 26S protease regulatory subunit 4 homolog (TAT-binding| homolog 5) Length = 437 Score = 28.1 bits (61), Expect = 6.5 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -1 Query: 218 LAXRERRMKVTHADFXXXXXXXXXXXKEGVPEGLYM 111 LA RERRM+VT DF E EGLY+ Sbjct: 402 LALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYL 437 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,410,119 Number of Sequences: 219361 Number of extensions: 496098 Number of successful extensions: 1364 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1364 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)