Clone Name | rbart07d12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | APSB_EMENI (O60039) Anucleate primary sterigmata protein B | 30 | 3.7 | 2 | TNIK_HUMAN (Q9UKE5) TRAF2 and NCK-interacting kinase (EC 2.7.11.1) | 29 | 4.8 |
---|
>APSB_EMENI (O60039) Anucleate primary sterigmata protein B| Length = 1051 Score = 29.6 bits (65), Expect = 3.7 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 1/80 (1%) Frame = +2 Query: 47 EWCPK-REELQAKHMHENTRKQRLDASRRDIAQNKRQTSANQSSLITLSESKRRKETASS 223 E C K ++ L A+ + NT K+RL ++ + + ++SSLI + K +KE S+ Sbjct: 580 EECRKLKKNLSAQEIETNTWKERLTDLENNLRETLGDLTGSRSSLIA-NIMKLQKELEST 638 Query: 224 LLTTHG*FSLLD*SVTALIN 283 L S LD T L N Sbjct: 639 ALELESTRSTLDEKETLLRN 658
>TNIK_HUMAN (Q9UKE5) TRAF2 and NCK-interacting kinase (EC 2.7.11.1)| Length = 1360 Score = 29.3 bits (64), Expect = 4.8 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +2 Query: 62 REELQAKHMHENTRKQRLDASRRDIAQNKRQTSANQSSLITLSESKRRK 208 R +L K E R+Q+L+ +R+ ++KRQ A + I + +RR+ Sbjct: 356 RLQLANKERSEALRRQQLEQQQRENEEHKRQLLAERQKRIEEQKEQRRR 404 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,688,078 Number of Sequences: 219361 Number of extensions: 765332 Number of successful extensions: 2376 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2315 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2374 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)