Clone Name | rbart07d09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y6G5_ENCCU (Q8SV60) Hypothetical protein ECU06_1650 | 32 | 0.85 | 2 | LEG3_MOUSE (P16110) Galectin-3 (Galactose-specific lectin 3) (Ma... | 30 | 4.2 | 3 | CRFR2_HUMAN (Q13324) Corticotropin-releasing factor receptor 2 p... | 28 | 9.4 | 4 | AA2DB_BRARE (Q8JG69) Alpha-2Db adrenergic receptor (Alpha-2Db ad... | 28 | 9.4 |
---|
>Y6G5_ENCCU (Q8SV60) Hypothetical protein ECU06_1650| Length = 391 Score = 32.0 bits (71), Expect = 0.85 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +1 Query: 349 IRGPDHAQIDHRRLN*TLATPPVAMPLL--CGSPAPYPPCSAGYP 477 +RGP+H +DH TL++P +A P L +P P P + YP Sbjct: 38 VRGPEHLAVDH-----TLSSPALAKPNLPVLSTPEPCSPPANPYP 77
>LEG3_MOUSE (P16110) Galectin-3 (Galactose-specific lectin 3) (Mac-2 antigen)| (IgE-binding protein) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Laminin-binding protein) (Lectin L-29) (L-34 galactoside-binding lectin) Length = 263 Score = 29.6 bits (65), Expect = 4.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 Query: 412 PVAMPLLCGSPAPYPPCSAGYP 477 P A P G+P YP CS GYP Sbjct: 94 PGAFPGQPGAPGAYPQCSGGYP 115
>CRFR2_HUMAN (Q13324) Corticotropin-releasing factor receptor 2 precursor (CRF-R| 2) (CRF2) (Corticotropin-releasing hormone receptor 2) (CRH-R 2) Length = 411 Score = 28.5 bits (62), Expect = 9.4 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 157 GTYLPTTHSHMVCLYAVSGEQLCDLLLIGWMLPHPGIV 44 G YL H+ +V Y+ + C L IGW +P P IV Sbjct: 206 GCYL---HTAIVMTYSTERLRKCLFLFIGWCIPFPIIV 240
>AA2DB_BRARE (Q8JG69) Alpha-2Db adrenergic receptor (Alpha-2Db adrenoceptor)| (Alpha-2Db adrenoreceptor) (Alpha(2Db)AR) Length = 415 Score = 28.5 bits (62), Expect = 9.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 153 LTCLLRTHTWFVYTLCPVSSFA 88 L CLL TW++ + C VS FA Sbjct: 177 LECLLNNETWYILSSCIVSFFA 198 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,412,943 Number of Sequences: 219361 Number of extensions: 1081785 Number of successful extensions: 2739 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2738 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)