| Clone Name | rbart07c07 |
|---|---|
| Clone Library Name | barley_pub |
>KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-associated| protein 10.7) (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) Length = 370 Score = 31.2 bits (69), Expect = 1.3 Identities = 17/50 (34%), Positives = 21/50 (42%) Frame = +3 Query: 285 VLCRHVN*QTMCHPPHKACRPKSNEAAACCALVCTGG*VAPLRCS*GACC 434 +LCR V C P C P S+ A+CC + CS ACC Sbjct: 311 LLCRPVCRPACCVPVPSCCAPTSSCQASCCRPASCVSLLCRPACSRPACC 360
>KR103_HUMAN (P60369) Keratin-associated protein 10-3 (Keratin-associated| protein 10.3) (High sulfur keratin-associated protein 10.3) (Keratin-associated protein 18-3) (Keratin-associated protein 18.3) Length = 221 Score = 31.2 bits (69), Expect = 1.3 Identities = 16/46 (34%), Positives = 19/46 (41%) Frame = +3 Query: 309 QTMCHPPHKACRPKSNEAAACCALVCTGG*VAPLRCS*GACCDFWC 446 ++ C PP C P A C LVCT P+ C CC C Sbjct: 24 ESCCEPP--CCAPSCCAPAPCLTLVCT-----PVSCVSSPCCQAAC 62
>ATP4A_XENLA (Q92126) Potassium-transporting ATPase alpha chain 1 (EC 3.6.3.10)| (Proton pump) (Gastric H+/K+ ATPase alpha subunit) Length = 1030 Score = 30.0 bits (66), Expect = 3.0 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 343 GPNPMKPPHAVPWYVQVARWLLFGV 417 GPN +KPP P Y++ AR L G+ Sbjct: 82 GPNELKPPKGTPEYIKFARQLAGGL 106
>YR731_MIMIV (Q5UNY1) Putative BTB/POZ domain and WD-repeat protein R731| Length = 518 Score = 30.0 bits (66), Expect = 3.0 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 7 LNMD*MNLVNIYTR-ILTSCQFHLVNSI 87 +NMD +L+++Y +LT CQ HL +SI Sbjct: 5 INMDKHSLIDLYNNEVLTDCQLHLTDSI 32
>ATP4A_RABIT (P27112) Potassium-transporting ATPase alpha chain 1 (EC 3.6.3.10)| (Proton pump) (Gastric H+/K+ ATPase alpha subunit) Length = 1034 Score = 29.6 bits (65), Expect = 3.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 343 GPNPMKPPHAVPWYVQVARWLLFGV 417 GPN ++PP P YV+ AR L G+ Sbjct: 86 GPNALRPPRGTPEYVKFARQLAGGL 110
>ATP4A_HUMAN (P20648) Potassium-transporting ATPase alpha chain 1 (EC 3.6.3.10)| (Proton pump) (Gastric H+/K+ ATPase alpha subunit) Length = 1034 Score = 29.6 bits (65), Expect = 3.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 343 GPNPMKPPHAVPWYVQVARWLLFGV 417 GPN ++PP P YV+ AR L G+ Sbjct: 86 GPNALRPPRGTPEYVKFARQLAGGL 110
>ATP4A_RAT (P09626) Potassium-transporting ATPase alpha chain 1 (EC 3.6.3.10)| (Proton pump) (Gastric H+/K+ ATPase alpha subunit) Length = 1032 Score = 29.6 bits (65), Expect = 3.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 343 GPNPMKPPHAVPWYVQVARWLLFGV 417 GPN ++PP P YV+ AR L G+ Sbjct: 84 GPNALRPPRGTPEYVKFARQLAGGL 108
>ATP4A_MOUSE (Q64436) Potassium-transporting ATPase alpha chain 1 (EC 3.6.3.10)| (Proton pump) (Gastric H+/K+ ATPase alpha subunit) Length = 1032 Score = 29.6 bits (65), Expect = 3.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 343 GPNPMKPPHAVPWYVQVARWLLFGV 417 GPN ++PP P YV+ AR L G+ Sbjct: 84 GPNALRPPRGTPEYVKFARQLAGGL 108
>SELU_BORBR (Q7WE96) tRNA 2-selenouridine synthase (EC 2.9.1.-)| (Selenophosphate-dependent tRNA 2-selenouridine synthase) Length = 368 Score = 29.6 bits (65), Expect = 3.9 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = -1 Query: 398 LATCTYQGTACGGFIGFGPTGLVRRMTHGLLVHMTTQHHGGTLDPESAHHP 246 +A C + GG G G T ++R++ HGL + H G + + P Sbjct: 139 IAECGF--VVLGGMTGTGKTDVLRQLDHGLDLEAHAHHRGSSFGKHATGQP 187
>ATP4A_PIG (P19156) Potassium-transporting ATPase alpha chain 1 (EC 3.6.3.10)| (Proton pump) (Gastric H+/K+ ATPase alpha subunit) Length = 1033 Score = 29.6 bits (65), Expect = 3.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 343 GPNPMKPPHAVPWYVQVARWLLFGV 417 GPN ++PP P YV+ AR L G+ Sbjct: 85 GPNALRPPRGTPEYVKFARQLAGGL 109
>ATP4A_CANFA (P50996) Potassium-transporting ATPase alpha chain 1 (EC 3.6.3.10)| (Proton pump) (Gastric H+/K+ ATPase alpha subunit) Length = 1033 Score = 29.6 bits (65), Expect = 3.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 343 GPNPMKPPHAVPWYVQVARWLLFGV 417 GPN ++PP P YV+ AR L G+ Sbjct: 85 GPNALRPPRGTPEYVKFARQLAGGL 109
>J1L_HCMVA (P17143) Hypothetical protein J1L| Length = 309 Score = 29.3 bits (64), Expect = 5.1 Identities = 21/62 (33%), Positives = 25/62 (40%), Gaps = 5/62 (8%) Frame = -3 Query: 291 TAPRRDLGP*VRPSPACRRFASPWE----HCFISWSPPTLFVTNESGK-HNAHPQASCLG 127 T R P RP CR+ PW+ C S TL N + H+A P C G Sbjct: 74 TVERTGSAPKHRPEARCRQ-QIPWDDTHRQCAGSVGHNTLTALNTPSRTHHAAPHRRCFG 132 Query: 126 CV 121 CV Sbjct: 133 CV 134
>CD2L7_CAEEL (P46551) Putative cell division cycle 2-related protein kinase 7| (EC 2.7.11.22) Length = 730 Score = 28.5 bits (62), Expect = 8.7 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = -1 Query: 302 HMTTQHHGGTLDPESAHHPPAGDLRRHGNTVSFHGHPP 189 H + HH +L P H PP ++ S + H P Sbjct: 681 HHHSHHHASSLPPSGGHAPPPPPPPTQASSTSHNNHQP 718
>KR123_HUMAN (P60328) Keratin-associated protein 12-3 (Keratin-associated| protein 12.3) (High sulfur keratin-associated protein 12.3) Length = 96 Score = 28.5 bits (62), Expect = 8.7 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 5/38 (13%) Frame = +3 Query: 336 ACRP-----KSNEAAACCALVCTGG*VAPLRCS*GACC 434 +CRP S +++ CC CT P+ CS +CC Sbjct: 59 SCRPIIYVTPSCQSSGCCQPPCTTALCRPISCSTPSCC 96
>KR101_HUMAN (P60331) Keratin-associated protein 10-1 (Keratin-associated| protein 10.1) (High sulfur keratin-associated protein 10.1) (Keratin-associated protein 18-1) (Keratin-associated protein 18.1) Length = 282 Score = 28.5 bits (62), Expect = 8.7 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = +3 Query: 285 VLCRHVN*QTMCHPPHKACRPKSNEAAACCALVCTGG*VAPLRCS*GAC 431 +LCR V C P C P S+ A+CC + CS AC Sbjct: 234 LLCRPVCRPACCMPVSSCCAPASSCQASCCRPASCVSLLCRPACSRPAC 282 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,591,271 Number of Sequences: 219361 Number of extensions: 1899315 Number of successful extensions: 5029 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 4780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5013 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)