Clone Name | rbart07b09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GSTU6_ORYSA (Q06398) Probable glutathione S-transferase GSTU6 (E... | 38 | 0.009 | 2 | GSTX2_MAIZE (P50472) Probable glutathione S-transferase BZ2 (EC ... | 35 | 0.10 | 3 | GSTU1_ORYSA (O65032) Probable glutathione S-transferase GSTU1 (E... | 32 | 0.85 | 4 | AMYG_NEUCR (P14804) Glucoamylase precursor (EC 3.2.1.3) (Glucan ... | 29 | 5.5 |
---|
>GSTU6_ORYSA (Q06398) Probable glutathione S-transferase GSTU6 (EC 2.5.1.18) (28| kDa cold-induced protein) Length = 236 Score = 38.1 bits (87), Expect = 0.009 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -3 Query: 429 VVGGTVSYVHAVARVSGERLFQDEGRTPLRAAWLRRFGELDAAVELL-QDVDRVVDY 262 V+GG + + A+ ++ G RL D RTP AAW RF DAA ++ D D+++++ Sbjct: 168 VLGGYLGWFTAIDKLIGRRLI-DPARTPALAAWEERFRATDAAKGVVPDDADKLLEF 223
>GSTX2_MAIZE (P50472) Probable glutathione S-transferase BZ2 (EC 2.5.1.18)| (Protein bronze-2) Length = 236 Score = 34.7 bits (78), Expect = 0.10 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = -3 Query: 405 VHAVARVSGERLFQDEGRTPLRAAWLRRFGELDAAVELLQDVDRVVDYVRFI 250 + A R+ G L D TPL W +RF AA +L D ++VV + RF+ Sbjct: 175 LRACERLHGLSLI-DASATPLLDGWSQRFAAHPAAKRVLPDTEKVVQFTRFL 225
>GSTU1_ORYSA (O65032) Probable glutathione S-transferase GSTU1 (EC 2.5.1.18)| Length = 231 Score = 31.6 bits (70), Expect = 0.85 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -3 Query: 369 FQDEGRTPLRAAWLRRFGELDAAVELLQDVDRVVDYV 259 F E P AAW RR G +D+ V+ L ++V D+V Sbjct: 185 FSVEEVAPRLAAWARRCGRIDSVVKHLPSPEKVYDFV 221
>AMYG_NEUCR (P14804) Glucoamylase precursor (EC 3.2.1.3) (Glucan| 1,4-alpha-glucosidase) (1,4-alpha-D-glucan glucohydrolase) Length = 626 Score = 28.9 bits (63), Expect = 5.5 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 335 AARSGVLPSSWNSLSPETLATACTYDTV 418 A R+G++P SW + S +L +C+ TV Sbjct: 462 ARRAGIVPPSWGAASANSLPGSCSASTV 489 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,486,997 Number of Sequences: 219361 Number of extensions: 883043 Number of successful extensions: 2020 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1994 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2020 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)