Clone Name | rbart07b08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HEMA_PTV10 (Q70KP1) Hemagglutinin-esterase homolog precursor (EC... | 31 | 1.8 | 2 | YOU3_CAEEL (P30639) Hypothetical protein ZK637.3 | 29 | 6.8 | 3 | FAS_MOUSE (P19096) Fatty acid synthase (EC 2.3.1.85) [Includes: ... | 28 | 8.9 |
---|
>HEMA_PTV10 (Q70KP1) Hemagglutinin-esterase homolog precursor (EC 3.1.1.53)| (HE) Length = 430 Score = 30.8 bits (68), Expect = 1.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -3 Query: 450 GLLKADPSYYXSFMVNETAFSKRYICPHKEAAP 352 G PS+Y +F N TA RYIC + E P Sbjct: 232 GYYYQSPSFYHAFYTNGTAGLHRYICDYLEMKP 264
>YOU3_CAEEL (P30639) Hypothetical protein ZK637.3| Length = 599 Score = 28.9 bits (63), Expect = 6.8 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 2 LSICVSI*HKDEQVHNHAMLSSLMIDEMEI 91 L + VSI KD +++NH + +S + DE EI Sbjct: 102 LDVLVSIRDKDTEIYNHTLWTSEIEDEKEI 131
>FAS_MOUSE (P19096) Fatty acid synthase (EC 2.3.1.85) [Includes:| [Acyl-carrier-protein] S-acetyltransferase (EC 2.3.1.38); [Acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39); 3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41); 3-oxoacyl-[acyl- Length = 2504 Score = 28.5 bits (62), Expect = 8.9 Identities = 19/54 (35%), Positives = 29/54 (53%) Frame = +1 Query: 247 VL*ASKFQYCVLSSCKYESSRHFPFASGCIVFSEVWCSLLVRAYVPLGESSLIH 408 VL +S F + V SS E + P +V++ + SL+VR + GE+ LIH Sbjct: 1619 VLLSSDFLWDVPSSWTLEEAASVP-----VVYTTAYYSLVVRGRIQRGETVLIH 1667 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,704,102 Number of Sequences: 219361 Number of extensions: 1096109 Number of successful extensions: 2179 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2179 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)