Clone Name | rbart07a09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LPXK_CAUCR (P58184) Tetraacyldisaccharide 4'-kinase (EC 2.7.1.13... | 29 | 7.3 | 2 | LIPA2_BRAJA (Q89NW6) Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid... | 29 | 7.3 |
---|
>LPXK_CAUCR (P58184) Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A| 4'-kinase) Length = 335 Score = 28.9 bits (63), Expect = 7.3 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 Query: 115 TTHNEWPFVQAKVFPAFRCGQA*NWNLLGRDLVILAMPYD 234 T EWPF +VFPA + L D VI+ +P D Sbjct: 167 TRGGEWPFGDGRVFPAGPMREPLKVGLSRADAVIVLLPVD 206
>LIPA2_BRAJA (Q89NW6) Lipoyl synthase 2 (EC 2.8.1.-) (Lipoic acid synthase 2)| (Lipoate synthase 2) (Lipoyl-acyl-carrier protein synthase 2) (Sulfur insertion protein lipA2) (Lip-syn 2) Length = 322 Score = 28.9 bits (63), Expect = 7.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 480 DVLEREPRRSHRGDRPRLPQMEQRP 406 D+L +PR + R +RPR P+ RP Sbjct: 6 DLLNNDPRTTQRTERPRHPEKANRP 30 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,836,396 Number of Sequences: 219361 Number of extensions: 1015680 Number of successful extensions: 2794 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2793 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)