ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart06g11 |
|---|---|
| Clone Library Name | barley_pub |
>TIP41_ORYSA (Q75GA5) Probable aquaporin TIP4.1 (Tonoplast intrinsic protein| 4.1) (OsTIP4.1) Length = 251 Score = 55.1 bits (131), Expect = 4e-08 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEPLLGWDF 200 IYW+GPL+GGPLAG V+E +F+VK+T EPLL F Sbjct: 217 IYWLGPLIGGPLAGLVYESLFLVKRTHEPLLDNSF 251
>TIP43_ORYSA (Q9LWR2) Probable aquaporin TIP4.3 (Tonoplast intrinsic protein| 4.3) (OsTIP4.3) Length = 251 Score = 45.8 bits (107), Expect = 3e-05 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEPL 215 IYWVGPL+GGPLAG V+E +FM EPL Sbjct: 215 IYWVGPLIGGPLAGLVYEGLFMGPPGHEPL 244
>AQP_DROME (Q9V5Z7) Aquaporin| Length = 245 Score = 42.0 bits (97), Expect = 4e-04 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEPLLGWDF 200 +YWVGP+ GG LAG ++ ++F V+K + +DF Sbjct: 211 VYWVGPIAGGLLAGIIYRLIFKVRKGDDETDSYDF 245
>TIP21_ARATH (Q41951) Aquaporin TIP2.1 (Tonoplast intrinsic protein 2.1)| (Delta-tonoplast intrinsic protein) (Delta-TIP) Length = 250 Score = 42.0 bits (97), Expect = 4e-04 Identities = 18/35 (51%), Positives = 22/35 (62%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEPLLGWDF 200 +YWVGPL+GG LAG ++ VFM PL DF Sbjct: 216 VYWVGPLIGGGLAGLIYGNVFMGSSEHVPLASADF 250
>TIP_ANTMA (P33560) Probable aquaporin TIP-type (Tonoplast intrinsic protein| DiP) (Dark intrinsic protein) Length = 250 Score = 40.8 bits (94), Expect = 9e-04 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEP 218 IYW GPL+GG LAGF++ VF+ P P Sbjct: 216 IYWAGPLIGGALAGFIYGDVFITAHAPLP 244
>TIP2_TOBAC (P24422) Probable aquaporin TIP-type RB7-18C (Tonoplast intrinsic| protein, root-specific RB7-18C) (TobRB7) (RT-TIP) Length = 250 Score = 40.4 bits (93), Expect = 0.001 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEP 218 IYW GPL+GG LAGF++ VF+ TP P Sbjct: 216 IYWAGPLIGGGLAGFIYGDVFIGCHTPLP 244
>TIP1_TOBAC (P21653) Probable aquaporin TIP-type RB7-5A (Tonoplast intrinsic| protein, root-specific RB7-5A) (TobRB7) (RT-TIP) Length = 250 Score = 40.4 bits (93), Expect = 0.001 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEP 218 IYW GPL+GG LAGF++ VF+ TP P Sbjct: 216 IYWAGPLIGGGLAGFIYGDVFIGCHTPLP 244
>TIP22_ARATH (Q41975) Probable aquaporin TIP2.2 (Tonoplast intrinsic protein| 2.2) Length = 250 Score = 40.0 bits (92), Expect = 0.001 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEP 218 IYWVGPLVGG LAG ++ VF+ P P Sbjct: 216 IYWVGPLVGGALAGLIYGDVFIGSYAPAP 244
>AQP_AEDAE (Q9NHW7) Aquaporin AQPAe.a| Length = 249 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPE 221 +YWVGP+VGG LAG V+ + F V+K E Sbjct: 217 VYWVGPIVGGILAGAVYRLFFKVRKGDE 244
>TIP11_ORYSA (P50156) Probable aquaporin TIP1.1 (Tonoplast intrinsic protein| 1.1) (OsTIP1.1) (rTIP1) Length = 250 Score = 39.3 bits (90), Expect = 0.003 Identities = 17/35 (48%), Positives = 25/35 (71%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEPLLGWDF 200 +YWVGPL+GG LAG ++E++F + T E L D+ Sbjct: 217 VYWVGPLIGGGLAGVIYEVLF-ISHTHEQLPTTDY 250
>TIP12_ARATH (Q41963) Aquaporin TIP1.2 (Tonoplast intrinsic protein 1.2)| (Gamma-tonoplast intrinsic protein 2) (Gamma-TIP2) (Salt stress-induced tonoplast intrinsic protein) Length = 253 Score = 39.3 bits (90), Expect = 0.003 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEPLLGWDF 200 +YW GPL+GG LAG +++ VF+ + E L D+ Sbjct: 219 VYWAGPLIGGGLAGIIYDFVFIDENAHEQLPTTDY 253
>TIP41_ARATH (O82316) Probable aquaporin TIP4.1 (Tonoplast intrinsic protein| 4.1) (Epsilon-tonoplast intrinsic protein) (Epsilon-TIP) Length = 249 Score = 38.9 bits (89), Expect = 0.003 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFM 239 +YWVGPL+GG LAGF++E V + Sbjct: 212 VYWVGPLIGGGLAGFIYENVLI 233
>AQP_CICVR (Q23808) Aquaporin AQPcic| Length = 255 Score = 38.9 bits (89), Expect = 0.003 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEPLLGWDF 200 +YW GP+VGG +AG + +F +K E +DF Sbjct: 221 VYWAGPIVGGVVAGITYRALFRARKPEEEASSYDF 255
>TIP22_ORYSA (Q5Z6F0) Probable aquaporin TIP2.2 (Tonoplast intrinsic protein| 2.2) (OsTIP2.2) Length = 248 Score = 38.9 bits (89), Expect = 0.003 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFM 239 IYWVGPLVGG LAG V+ V+M Sbjct: 215 IYWVGPLVGGGLAGLVYRYVYM 236
>TIP11_ARATH (P25818) Aquaporin TIP1.1 (Tonoplast intrinsic protein 1.1)| (Gamma-tonoplast intrinsic protein) (Gamma-TIP) (Aquaporin-TIP) (Tonoplast intrinsic protein, root-specific RB7) Length = 251 Score = 38.5 bits (88), Expect = 0.004 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEPLLGWDF 200 +YW GPLVGG +AG ++E VF + T E L D+ Sbjct: 218 VYWAGPLVGGGIAGLIYE-VFFINTTHEQLPTTDY 251
>TIP1_MEDTR (Q9FY14) Probable aquaporin TIP-type (MtAQP1)| Length = 250 Score = 38.1 bits (87), Expect = 0.006 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEPLLGWDF 200 +YW GPL+GG +AG V+E++F + T E L D+ Sbjct: 217 VYWAGPLIGGGIAGLVYEVLF-INSTHEQLPTTDY 250
>TIP1_MEDSA (P42067) Probable aquaporin TIP-type (Membrane channel protein 1)| (MsMCP1) Length = 249 Score = 38.1 bits (87), Expect = 0.006 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEPLLGWDF 200 +YW GPL+GG +AG V+E++F + T E L D+ Sbjct: 216 VYWAGPLIGGGIAGLVYEVLF-INSTHEQLPTTDY 249
>TIP42_ORYSA (Q9LWR0) Probable aquaporin TIP4.2 (Tonoplast intrinsic protein| 4.2) (OsTIP4.2) Length = 251 Score = 38.1 bits (87), Expect = 0.006 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFM 239 +YWVGPL GGPLA +E++FM Sbjct: 215 VYWVGPLAGGPLAVVAYELLFM 236
>AQP_HAEIE (Q25074) Aquaporin (Water channel 1) (BfWC1)| Length = 251 Score = 37.4 bits (85), Expect = 0.010 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEPLLGWDF 200 +YWVGP+VG +A +++ VF V+K + +DF Sbjct: 217 VYWVGPIVGAIVAALLYKFVFKVRKGDDEANSYDF 251
>TIP23_ARATH (Q9FGL2) Probable aquaporin TIP2.3 (Tonoplast intrinsic protein| 2.3) Length = 250 Score = 37.0 bits (84), Expect = 0.013 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFM 239 IYWVGPLVGG LAG ++ VF+ Sbjct: 216 IYWVGPLVGGALAGLIYGDVFI 237
>TIP13_ARATH (O82598) Putative aquaporin TIP1.3 (Tonoplast intrinsic protein| 1.3) (Gamma-tonoplast intrinsic protein 3) (Gamma-TIP3) Length = 252 Score = 37.0 bits (84), Expect = 0.013 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEPLLGWDF 200 +YWVGP +G +A V++ +F+ EPL DF Sbjct: 218 VYWVGPFIGAAIAAIVYDTIFIGSNGHEPLPSNDF 252
>TIP21_ORYSA (Q7XA61) Probable aquaporin TIP2.1 (Tonoplast intrinsic protein| 2.1) (OsTIP2.1) Length = 248 Score = 36.6 bits (83), Expect = 0.017 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTP 224 +YWVGPL+GG LAG V+ VF+ P Sbjct: 215 VYWVGPLIGGGLAGLVYGDVFIGSYQP 241
>AQP4_RAT (P47863) Aquaporin-4 (AQP-4) (WCH4) (Mercurial-insensitive water| channel) (MIWC) Length = 323 Score = 34.7 bits (78), Expect = 0.063 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVF 242 IYWVGP++G LAG ++E VF Sbjct: 232 IYWVGPIIGAVLAGALYEYVF 252
>TIP32_ORYSA (Q7XKI5) Probable aquaporin TIP3.2 (Tonoplast intrinsic protein| 3.2) (OsTIP3.2) Length = 265 Score = 34.7 bits (78), Expect = 0.063 Identities = 13/29 (44%), Positives = 22/29 (75%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEP 218 +YW+GPL+G +AG ++E F++ + PEP Sbjct: 224 VYWLGPLIGAGMAGALYE--FVMAEQPEP 250
>AQP4_HUMAN (P55087) Aquaporin-4 (AQP-4) (WCH4) (Mercurial-insensitive water| channel) (MIWC) Length = 323 Score = 34.3 bits (77), Expect = 0.082 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVF 242 IYWVGP++G LAG ++E VF Sbjct: 232 IYWVGPIIGAVLAGGLYEYVF 252
>AQP4_BOVIN (O77750) Aquaporin-4 (AQP-4) (WCH4) (Mercurial-insensitive water| channel) (MIWC) Length = 323 Score = 34.3 bits (77), Expect = 0.082 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVF 242 IYWVGP++G LAG ++E VF Sbjct: 232 IYWVGPIIGAVLAGGLYEYVF 252
>BIB_DROME (P23645) Neurogenic protein big brain| Length = 696 Score = 34.3 bits (77), Expect = 0.082 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVF 242 +YW GPLVGG +G V+E +F Sbjct: 257 VYWFGPLVGGMASGLVYEYIF 277
>AQP4_DIPME (Q923J4) Aquaporin-4 (AQP-4)| Length = 324 Score = 34.3 bits (77), Expect = 0.082 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVF 242 IYWVGP++G LAG ++E VF Sbjct: 232 IYWVGPIIGAVLAGGLYEYVF 252
>MIP_RANPI (Q06019) Lens fiber major intrinsic protein (MIP26) (MP26)| Length = 263 Score = 33.9 bits (76), Expect = 0.11 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMV 245 +YWVGP++GG L G V++ + Sbjct: 203 VYWVGPIIGGALGGLVYDFI 222
>AQP4_MOUSE (P55088) Aquaporin-4 (AQP-4) (WCH4) (Mercurial-insensitive water| channel) (MIWC) Length = 323 Score = 33.9 bits (76), Expect = 0.11 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVF 242 IYWVGP++G LAG ++E VF Sbjct: 232 IYWVGPIMGAVLAGALYEYVF 252
>TIP32_ARATH (O22588) Probable aquaporin TIP3.2 (Tonoplast intrinsic protein| 3.2) (Beta-tonoplast intrinsic protein) (Beta-TIP) Length = 267 Score = 33.1 bits (74), Expect = 0.18 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEP 218 IYWVGP +GG LA ++E + + P Sbjct: 226 IYWVGPFIGGALAALIYEYMIIPSVNEPP 254
>TIP12_ORYSA (Q94CS9) Probable aquaporin TIP1.2 (Tonoplast intrinsic protein| 1.2) (OsTIP1.2) Length = 252 Score = 32.3 bits (72), Expect = 0.31 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEPLLGWDF 200 +YW+GP VG +A +++++F+ ++ + L D+ Sbjct: 218 VYWLGPFVGAAIAALIYDIIFIGQRPHDQLPTADY 252
>TIP31_ARATH (P26587) Aquaporin TIP3.1 (Tonoplast intrinsic protein 3.1)| (Alpha-tonoplast intrinsic protein) (Alpha-TIP) Length = 268 Score = 32.0 bits (71), Expect = 0.41 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEP 218 IYWVGP +G LA ++E +MV T P Sbjct: 226 IYWVGPFIGSALAALIYE--YMVIPTEPP 252
>TIP51_ARATH (Q9STX9) Putative aquaporin TIP5.1 (Tonoplast intrinsic protein| 5.1) Length = 256 Score = 30.8 bits (68), Expect = 0.91 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMV 245 +YWVGPL+GG A V++ V Sbjct: 219 VYWVGPLLGGATAALVYDNV 238
>TIPA_PHAVU (P23958) Probable aquaporin TIP-type alpha (Tonoplast intrinsic| protein alpha) (Alpha TIP) Length = 256 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 4/39 (10%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTP----EPLLGWDF 200 I+WVGPL+G LA V+E + + P +PL D+ Sbjct: 218 IFWVGPLLGAALAALVYEYAVIPIEPPPHHHQPLATEDY 256
>AQPZ_SYNY3 (P73809) Aquaporin Z| Length = 247 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEP 218 ++W+ P+ G LAGFV+ V PEP Sbjct: 216 LFWLAPIAGALLAGFVYHNVLEDLGRPEP 244
>TIP31_ORYSA (Q9FWV6) Probable aquaporin TIP3.1 (Tonoplast intrinsic protein| 3.1) (OsTIP3.1) Length = 264 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEP 218 +YW+GP VG LAG ++E + + P Sbjct: 223 VYWLGPFVGAGLAGLLYEYLVIPSADAAP 251
>AQP1_PONPY (Q5R819) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 268 Score = 29.6 bits (65), Expect = 2.0 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMV 245 I+WVGP +GG LA +++ + Sbjct: 210 IFWVGPFIGGALAVLIYDFI 229
>AQP1_MOUSE (Q02013) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) (Early response protein DER2) Length = 268 Score = 29.6 bits (65), Expect = 2.0 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMV 245 I+WVGP +GG LA +++ + Sbjct: 210 IFWVGPFIGGALAVLIYDFI 229
>AQP1_HUMAN (P29972) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) (Urine water channel) Length = 268 Score = 29.6 bits (65), Expect = 2.0 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMV 245 I+WVGP +GG LA +++ + Sbjct: 210 IFWVGPFIGGALAVLIYDFI 229
>AQP1_CANFA (Q9N2J4) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 270 Score = 29.6 bits (65), Expect = 2.0 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMV 245 I+WVGP +GG LA +++ + Sbjct: 212 IFWVGPFIGGALAVLIYDFI 231
>AQPA_RANES (P50501) Aquaporin FA-CHIP| Length = 272 Score = 29.6 bits (65), Expect = 2.0 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMV 245 I+WVGP++GG A +++ + Sbjct: 215 IFWVGPMIGGAAAAIIYDFI 234
>AQP5_HUMAN (P55064) Aquaporin-5 (AQP-5)| Length = 265 Score = 29.6 bits (65), Expect = 2.0 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 12/46 (26%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVF------------EMVFMVKKTPEPLLGWD 203 ++WVGP+VG LA ++ E V ++K T EP W+ Sbjct: 205 VFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWE 250
>AQP1_PIG (Q6PQZ1) Aquaporin-1 (AQP-1) (Aquaporin-CHIP) (Water channel| protein for red blood cells and kidney proximal tubule) Length = 270 Score = 29.3 bits (64), Expect = 2.6 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMV 245 ++WVGP +GG LA +++ + Sbjct: 212 VFWVGPFIGGALAVLIYDFI 231
>MIP_RAT (P09011) Lens fiber major intrinsic protein (Aquaporin-0) (MIP26)| (MP26) (Fragment) Length = 261 Score = 29.3 bits (64), Expect = 2.6 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMV 245 +YWVGP++GG L +++ + Sbjct: 201 VYWVGPIIGGGLGSLLYDFL 220
>MIP_MOUSE (P51180) Lens fiber major intrinsic protein (Aquaporin-0) (MIP26)| (MP26) Length = 263 Score = 29.3 bits (64), Expect = 2.6 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMV 245 +YWVGP++GG L +++ + Sbjct: 203 VYWVGPIIGGGLGSLLYDFL 222
>MIP_HUMAN (P30301) Lens fiber major intrinsic protein (Aquaporin-0) (MIP26)| (MP26) Length = 263 Score = 29.3 bits (64), Expect = 2.6 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMV 245 +YWVGP++GG L +++ + Sbjct: 203 VYWVGPIIGGGLGSLLYDFL 222
>MIP_CAVPO (Q6RZ07) Lens fiber major intrinsic protein (Aquaporin-0)| Length = 263 Score = 29.3 bits (64), Expect = 2.6 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMV 245 +YWVGP++GG L +++ + Sbjct: 203 VYWVGPIIGGGLGSLLYDFL 222
>AQP5_RAT (P47864) Aquaporin-5 (AQP-5)| Length = 265 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 12/46 (26%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVF------------EMVFMVKKTPEPLLGWD 203 ++WVGP+VG LA ++ + V +VK T EP W+ Sbjct: 205 VFWVGPIVGAMLAAILYFYLLFPSSLSLHDRVAVVKGTYEPEEDWE 250
>AQP5_MOUSE (Q9WTY4) Aquaporin-5 (AQP-5)| Length = 265 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 12/46 (26%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVF------------EMVFMVKKTPEPLLGWD 203 ++WVGP+VG LA ++ + V +VK T EP W+ Sbjct: 205 VFWVGPIVGAVLAAILYFYLLFPSSLSLHDRVAVVKGTYEPEEDWE 250
>AQPZ_RHOPA (P60925) Aquaporin Z| Length = 240 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEP 218 ++WV PL+GG L G ++ ++ +PEP Sbjct: 207 LFWVAPLLGGVLGGVIYRVL-----SPEP 230
>PLF2_MOUSE (P04768) Proliferin-2 precursor (Mitogen-regulated protein 2)| Length = 224 Score = 28.5 bits (62), Expect = 4.5 Identities = 20/70 (28%), Positives = 33/70 (47%) Frame = +2 Query: 95 LYMAGNKSFSNIDCLIHTGLHCKMQLQVCEQFAFLKVPTKQRLGRLLHHEDHLKDKTGQR 274 L+ K +SN+ +GL K ++ +FL P + RL H+ LK +G Sbjct: 65 LFNEFEKHYSNV-----SGLRDKSPMRC--NTSFLPTPENKEQARLTHYAALLK--SGAM 115 Query: 275 TTDQWANPID 304 +D W +P+D Sbjct: 116 ISDAWESPLD 125
>TIP51_ORYSA (Q7XU31) Probable aquaporin TIP5.1 (Tonoplast intrinsic protein| 5.1) (OsTIP5.1) Length = 269 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFE-MVFMVKKTPEP 218 +YW GP+VG +A V + +VF P P Sbjct: 222 VYWAGPMVGAAVAALVHQALVFPTVPEPAP 251
>MAML1_MOUSE (Q6T264) Mastermind-like protein 1 (Mam-1)| Length = 1020 Score = 28.5 bits (62), Expect = 4.5 Identities = 16/57 (28%), Positives = 23/57 (40%), Gaps = 5/57 (8%) Frame = +2 Query: 149 GLHCKMQLQVCEQ-----FAFLKVPTKQRLGRLLHHEDHLKDKTGQRTTDQWANPID 304 GLHC V FA+ P L + H D + RT+++W N +D Sbjct: 958 GLHCAQAYPVRTMGQELPFAYSGQPGSSGLSSVAGHTDLIDSLLKNRTSEEWINELD 1014
>TNR19_MOUSE (Q9JLL3) Tumor necrosis factor receptor superfamily member 19| precursor (Toxicity and JNK inducer) (TRADE) Length = 416 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -3 Query: 213 LVGTFRKANCSHTCNCIL-QCKPVCIRQSMLL 121 LV F++ANCSHT + + C P R++ L+ Sbjct: 97 LVNRFQRANCSHTSDAVCGDCLPGFYRKTKLV 128
>AQY1_YEAST (P53386) Aquaporin-1| Length = 327 Score = 28.1 bits (61), Expect = 5.9 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKT 227 IYW+GPL+G LA V++++ ++ T Sbjct: 250 IYWIGPLLGSILAWSVWQLLQILDYT 275
>AQPZ1_RHIME (Q92NM3) Aquaporin Z 1| Length = 228 Score = 28.1 bits (61), Expect = 5.9 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMV 245 ++WV PL+G +AG V+++V Sbjct: 205 LFWVAPLIGAVIAGIVWKIV 224
>HAO_NITEU (Q50925) Hydroxylamine oxidoreductase precursor (EC 1.7.3.4) (HAO)| Length = 570 Score = 27.7 bits (60), Expect = 7.7 Identities = 13/54 (24%), Positives = 23/54 (42%) Frame = -1 Query: 305 DLLGWPIGRWSVGRFCL*DGLHGEEDARASAWLGLLGKQIARILVIAFCNVNRC 144 D + WP G+W GR L + + W + +++A + N N+C Sbjct: 212 DTMVWPNGQWPAGRPS--HALDYTANIETTVWAAMPQREVAEGCTMCHTNQNKC 263
>AQP6_RAT (Q9WTY0) Aquaporin-6 (AQP-6)| Length = 276 Score = 27.7 bits (60), Expect = 7.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMV 245 I+WVGPL G LA ++ + Sbjct: 212 IFWVGPLTGAVLASLIYNFI 231
>AQP6_HUMAN (Q13520) Aquaporin-6 (AQP-6) (Aquaporin-2-like) (hKID)| Length = 282 Score = 27.7 bits (60), Expect = 7.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMV 245 ++WVGPL+G LA ++ V Sbjct: 215 VFWVGPLMGALLASLIYNFV 234
>AQP6_MOUSE (Q8C4A0) Aquaporin-6 (AQP-6)| Length = 293 Score = 27.7 bits (60), Expect = 7.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMV 245 I+WVGPL G LA ++ + Sbjct: 212 IFWVGPLTGAVLASLIYNFI 231
>AQPZ_BRAJA (Q89EG9) Aquaporin Z| Length = 240 Score = 27.7 bits (60), Expect = 7.7 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVF 254 ++WV PL+GG L G ++ Sbjct: 207 LFWVAPLIGGALGGVIY 223
>PIP26_ARATH (Q9ZV07) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2e) (PIP2e) Length = 289 Score = 27.7 bits (60), Expect = 7.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMV 245 I+WVGP VG +A F + V Sbjct: 249 IFWVGPFVGAAIAAFYHQFV 268
>LGT_ERWCT (Q6D8I7) Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)| Length = 289 Score = 27.7 bits (60), Expect = 7.7 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKTPEPLLGWDF*ESKLLAYL 173 ++W G + L GFVF M V++ +P GW E + L Y+ Sbjct: 24 LHWYGLMY---LVGFVFAMWLAVRRANKPGSGWTKDEVENLLYM 64
>AQY2_YEAST (O93938) Aquaporin-2| Length = 289 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = -2 Query: 304 IYWVGPLVGGPLAGFVFEMVFMVKKT 227 IYW+GPL+G LA V++++ ++ T Sbjct: 249 IYWIGPLLGAFLAWSVWQLLQILDYT 274 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,358,496 Number of Sequences: 219361 Number of extensions: 783372 Number of successful extensions: 2115 Number of sequences better than 10.0: 65 Number of HSP's better than 10.0 without gapping: 2043 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2113 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
