Clone Name | rbart06g08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ACC4B_BRARE (Q708S3) Amiloride-sensitive cation channel 4-B (Aci... | 32 | 0.57 | 2 | PRR37_ORYSA (Q689G8) Two-component response regulator-like PRR37... | 29 | 3.7 | 3 | ACC4A_BRARE (Q708S4) Amiloride-sensitive cation channel 4-A (Aci... | 29 | 3.7 |
---|
>ACC4B_BRARE (Q708S3) Amiloride-sensitive cation channel 4-B (Acid-sensing ion| channel 4.2) (ZASIC4.2) Length = 558 Score = 31.6 bits (70), Expect = 0.57 Identities = 18/46 (39%), Positives = 23/46 (50%) Frame = -1 Query: 197 ACLAEQYAKVLIFPLFLCTLSNLNDFQLPV*IQIDIYHLCDLCHFP 60 A L E+ + L FP TL N+N F+ DIYHL +L P Sbjct: 102 AALREETRRELTFPAI--TLCNVNRFRFSALTDADIYHLANLTGLP 145
>PRR37_ORYSA (Q689G8) Two-component response regulator-like PRR37| (Pseudo-response regulator 37) (OsPRR37) Length = 742 Score = 28.9 bits (63), Expect = 3.7 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +2 Query: 53 GERGNGTGHINDIYLSEFTQEVENHSDLTEYKER 154 G G+G+G ND+YL FTQ + + +++++ Sbjct: 659 GGNGSGSGSGNDMYLKRFTQREHRVAAVIKFRQK 692
>ACC4A_BRARE (Q708S4) Amiloride-sensitive cation channel 4-A (Acid-sensing ion| channel 4.1) (ZASIC4.1) Length = 539 Score = 28.9 bits (63), Expect = 3.7 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -1 Query: 191 LAEQYAKVLIFPLFLCTLSNLNDFQLPV*IQIDIYHLCDLCHFP 60 L E+ ++FP T+ N+N F+ DIYHL +L P Sbjct: 100 LNEEATPEMVFPAV--TICNINRFRFSALTDADIYHLANLTGLP 141 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,928,339 Number of Sequences: 219361 Number of extensions: 651577 Number of successful extensions: 1407 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1407 length of database: 80,573,946 effective HSP length: 58 effective length of database: 67,851,008 effective search space used: 1628424192 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)