| Clone Name | rbart06g06 |
|---|---|
| Clone Library Name | barley_pub |
>UMP7_ARATH (Q9FMV1) Unknown mitochondrial protein At5g63510| Length = 252 Score = 67.0 bits (162), Expect = 1e-11 Identities = 34/52 (65%), Positives = 37/52 (71%) Frame = -2 Query: 314 ARFVRKLPNEEIMEIPKLAVAINDLMQSHF*EFLPYFNAYWEVEKLKKSFSI 159 ARF+R L NEE +EIPKLAVAIN L +F EFLPY Y EVEK KKS I Sbjct: 199 ARFIRTLTNEETLEIPKLAVAINHLSGDYFSEFLPYSTVYLEVEKFKKSLGI 250
>UMP8_ARATH (Q9SMN1) Unknown mitochondrial protein At3g48680| Length = 256 Score = 66.6 bits (161), Expect = 1e-11 Identities = 34/52 (65%), Positives = 37/52 (71%) Frame = -2 Query: 314 ARFVRKLPNEEIMEIPKLAVAINDLMQSHF*EFLPYFNAYWEVEKLKKSFSI 159 ARF+R L NEE +EIPKLAVAIN L +F EFLPY Y EVEK KKS I Sbjct: 203 ARFIRTLTNEETLEIPKLAVAINHLSGDYFSEFLPYSTIYLEVEKFKKSLGI 254
>AMPL_BOVIN (P00727) Cytosol aminopeptidase (EC 3.4.11.1) (Leucine| aminopeptidase) (LAP) (Leucyl aminopeptidase) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase) Length = 487 Score = 31.6 bits (70), Expect = 0.52 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = +1 Query: 4 QGRPRFTTMNKKFNVTNGPRLPIKLNTKLPSIRAALFPHSFAGRGKTRSYQGIENDF 174 + P+FT+ + FN +L LN PS++A GKTR++ G+ DF Sbjct: 15 EDEPQFTSAGENFNKLVSGKLREILNISGPSLKA----------GKTRTFYGLHEDF 61
>AMPL_MOUSE (Q9CPY7) Cytosol aminopeptidase (EC 3.4.11.1) (Leucine| aminopeptidase) (LAP) (Leucyl aminopeptidase) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase) Length = 487 Score = 30.0 bits (66), Expect = 1.5 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +1 Query: 13 PRFTTMNKKFNVTNGPRLPIKLNTKLPSIRAALFPHSFAGRGKTRSYQGIENDF 174 P+FT+ + FN +L LN P ++A GKTR++ G+ DF Sbjct: 18 PQFTSAGESFNKLVSGKLREMLNISGPPLKA----------GKTRTFYGLHQDF 61
>AMPL_HUMAN (P28838) Cytosol aminopeptidase (EC 3.4.11.1) (Leucine| aminopeptidase) (LAP) (Leucyl aminopeptidase) (Proline aminopeptidase) (EC 3.4.11.5) (Prolyl aminopeptidase) (Peptidase S) Length = 487 Score = 28.1 bits (61), Expect = 5.8 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +1 Query: 13 PRFTTMNKKFNVTNGPRLPIKLNTKLPSIRAALFPHSFAGRGKTRSYQGIENDF 174 P+FT+ + F+ +L LN P ++A GKTR++ G+ DF Sbjct: 18 PQFTSAGENFDKLLAGKLRETLNISGPPLKA----------GKTRTFYGLHQDF 61
>FRI1_PEA (P19975) Ferritin-1, chloroplast precursor (EC 1.16.3.1)| Length = 253 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 317 LARFVRKLPNEEIMEIPKLAVAINDLMQSHF*E 219 LA + KL NE+++ + +A NDL +HF E Sbjct: 177 LALSLEKLTNEKLLNVHSVAERNNDLEMTHFIE 209 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,435,497 Number of Sequences: 219361 Number of extensions: 835953 Number of successful extensions: 1636 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1634 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)