Clone Name | rbart06g02 |
---|---|
Clone Library Name | barley_pub |
>CAHH_VACCV (P04195) Cell surface-binding protein (Carbonic anhydrase homolog)| Length = 304 Score = 29.6 bits (65), Expect = 3.5 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +2 Query: 200 LPSLLSPTKFQTKTRRNACRXPPPRHHYCQSSPMQISGAAGIVR 331 +P LSP +TK + R P HY +S P I +VR Sbjct: 1 MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVR 44
>CAHH_VACCT (Q9JFA1) Cell surface-binding protein (Carbonic anhydrase homolog)| Length = 304 Score = 29.6 bits (65), Expect = 3.5 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +2 Query: 200 LPSLLSPTKFQTKTRRNACRXPPPRHHYCQSSPMQISGAAGIVR 331 +P LSP +TK + R P HY +S P I +VR Sbjct: 1 MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVR 44
>CAHH_VACCC (P20508) Cell surface-binding protein (Carbonic anhydrase homolog)| Length = 304 Score = 29.6 bits (65), Expect = 3.5 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +2 Query: 200 LPSLLSPTKFQTKTRRNACRXPPPRHHYCQSSPMQISGAAGIVR 331 +P LSP +TK + R P HY +S P I +VR Sbjct: 1 MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVR 44
>CAHH_VACCA (O57211) Cell surface-binding protein (Carbonic anhydrase homolog)| Length = 304 Score = 29.6 bits (65), Expect = 3.5 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +2 Query: 200 LPSLLSPTKFQTKTRRNACRXPPPRHHYCQSSPMQISGAAGIVR 331 +P LSP +TK + R P HY +S P I +VR Sbjct: 1 MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVR 44
>CAHH_RABPU (Q6RZI9) Cell surface-binding protein (Carbonic anhydrase homolog)| Length = 304 Score = 29.6 bits (65), Expect = 3.5 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +2 Query: 200 LPSLLSPTKFQTKTRRNACRXPPPRHHYCQSSPMQISGAAGIVR 331 +P LSP +TK + R P HY +S P I +VR Sbjct: 1 MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVR 44
>Y140_MYCGE (P47386) Hypothetical ATP-dependent helicase MG140 (EC 3.6.1.-)| Length = 1113 Score = 29.3 bits (64), Expect = 4.6 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +2 Query: 113 PAIALWQTPAKSKPLLHSEKKLE*EAFVSLPSLLSPTKFQT 235 P L+ P+ LL + K + E + SL SPTKF+T Sbjct: 524 PKHVLFYKPSNKSQLLLKQLKQDVEQYTSLQRFQSPTKFET 564
>YL126_MIMIV (Q5UPK2) Putative F-box protein L126| Length = 255 Score = 28.9 bits (63), Expect = 6.0 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 30 YIYGTSIFEYFHHSYRHKREYPMPMKIVQPLRY 128 Y YG E +H+SYR Y P + ++Y Sbjct: 95 YNYGVIFLEKYHNSYRENEVYYKPYPLFDSIKY 127
>GTR5_BOVIN (P58353) Solute carrier family 2, facilitated glucose transporter| member 5 (Glucose transporter type 5, small intestine) (Fructose transporter) (Fragment) Length = 204 Score = 28.9 bits (63), Expect = 6.0 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = -2 Query: 188 LLILAFFLNGGEVLIXPVSAIAQWLDNFHGHWVFPFVPV 72 LL+ FL V+ WL NF VFPF+ V Sbjct: 145 LLVTEIFLQSSRPAAYMVAGTVHWLSNFTVGLVFPFIQV 183
>GTR5_HORSE (Q863Y9) Solute carrier family 2, facilitated glucose transporter| member 5 (Glucose transporter type 5, small intestine) (Fructose transporter) Length = 501 Score = 28.5 bits (62), Expect = 7.9 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -2 Query: 188 LLILAFFLNGGEVLIXPVSAIAQWLDNFHGHWVFPFVPV 72 LLI FL V WL NF VFPF+ V Sbjct: 397 LLITEVFLQSSRSAAYMVGGTVHWLSNFAVGLVFPFIQV 435 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,271,893 Number of Sequences: 219361 Number of extensions: 1142349 Number of successful extensions: 2778 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2777 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)