Clone Name | rbart06f08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RW1_MOUSE (O70472) RW1 protein | 32 | 1.1 | 2 | RW1_HUMAN (Q92545) RW1 protein (Fragment) | 29 | 5.3 | 3 | DPO3X_SALTY (P74876) DNA polymerase III tau subunit (EC 2.7.7.7)... | 28 | 9.1 |
---|
>RW1_MOUSE (O70472) RW1 protein| Length = 1829 Score = 31.6 bits (70), Expect = 1.1 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +3 Query: 57 LLIPLAAGYFF-LFFTYICIIMHIDRHLRIDSNASKIRPNLRPFS 188 L++P +GY F LFF MHID ++ + +NASK +R ++ Sbjct: 441 LILPNESGYIFTLFFMPSTSSMHIDNNILLVTNASKFHLPVRVYT 485
>RW1_HUMAN (Q92545) RW1 protein (Fragment)| Length = 1805 Score = 29.3 bits (64), Expect = 5.3 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +3 Query: 57 LLIPLAAGYFF-LFFTYICIIMHIDRHLRIDSNASKIRPNLRPFS 188 L++P +GY F L F MHID ++ + +NASK +R ++ Sbjct: 413 LILPNESGYIFTLLFMPSTSSMHIDNNILLITNASKFHLPVRVYT 457
>DPO3X_SALTY (P74876) DNA polymerase III tau subunit (EC 2.7.7.7) [Contains: DNA| polymerase III gamma subunit] Length = 642 Score = 28.5 bits (62), Expect = 9.1 Identities = 19/44 (43%), Positives = 26/44 (59%) Frame = +2 Query: 323 AAHHCHRRPWSASVAGQSLPVEGLLEALQVLGLQREQHGHAVVL 454 AA R PW+A V+ SLP L+E + L +EQ+G+AV L Sbjct: 513 AAEAIERDPWAAQVSQLSLP--KLVEQV-ALNAWKEQNGNAVCL 553 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,505,371 Number of Sequences: 219361 Number of extensions: 1105496 Number of successful extensions: 3116 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3051 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3116 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)