| Clone Name | rbart06e09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PGFRA_MOUSE (P26618) Alpha platelet-derived growth factor recept... | 31 | 1.4 | 2 | PGFRA_HUMAN (P16234) Alpha platelet-derived growth factor recept... | 31 | 1.4 | 3 | PGFRA_RAT (P20786) Alpha platelet-derived growth factor receptor... | 31 | 1.4 | 4 | O10A3_HUMAN (P58181) Olfactory receptor 10A3 (HTPCRX12) | 30 | 3.1 | 5 | HYPA_CLOPE (Q46205) Protein hypA | 29 | 5.2 |
|---|
>PGFRA_MOUSE (P26618) Alpha platelet-derived growth factor receptor precursor (EC| 2.7.10.1) (PDGF-R-alpha) Length = 1089 Score = 31.2 bits (69), Expect = 1.4 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = +3 Query: 114 PLPSVNPIPES*TMGKQHQHKSE 182 PLP ++P+PE +GK+++H S+ Sbjct: 1021 PLPDIDPVPEEEDLGKRNRHSSQ 1043
>PGFRA_HUMAN (P16234) Alpha platelet-derived growth factor receptor precursor (EC| 2.7.10.1) (PDGF-R-alpha) (CD140a antigen) Length = 1089 Score = 31.2 bits (69), Expect = 1.4 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = +3 Query: 114 PLPSVNPIPES*TMGKQHQHKSE 182 PLP ++P+PE +GK+++H S+ Sbjct: 1021 PLPDIDPVPEEEDLGKRNRHSSQ 1043
>PGFRA_RAT (P20786) Alpha platelet-derived growth factor receptor precursor (EC| 2.7.10.1) (PDGF-R-alpha) Length = 1088 Score = 31.2 bits (69), Expect = 1.4 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = +3 Query: 114 PLPSVNPIPES*TMGKQHQHKSE 182 PLP ++P+PE +GK+++H S+ Sbjct: 1020 PLPDIDPVPEEEDLGKRNRHSSQ 1042
>O10A3_HUMAN (P58181) Olfactory receptor 10A3 (HTPCRX12)| Length = 314 Score = 30.0 bits (66), Expect = 3.1 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +1 Query: 4 SHTTSILLVSSLYETINVPYTLPQF*YSPPLSQTMAIPFHP*TQYLNP 147 SH TS+ L Y T N+ Y P+ YSP + +++ + T LNP Sbjct: 243 SHLTSVTL---FYGTANMTYLQPKSGYSPETKKLISLAYTLLTPLLNP 287
>HYPA_CLOPE (Q46205) Protein hypA| Length = 973 Score = 29.3 bits (64), Expect = 5.2 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Frame = -1 Query: 203 FNISGSEFRFVLVLLAHCSGFRYWVYGWKGIAIVCDKGGLYQNCGRVYGTLIVSYRD-DT 27 + G ++ L LL GF Y W + + G++ N R G IVSYRD + Sbjct: 801 YKTHGYKYSGALSLLESILGFDYL---WNAVRVKGGAYGVFSNFRRDGGAYIVSYRDPNI 857 Query: 26 SSILVVWD 3 S L +D Sbjct: 858 KSTLEAYD 865 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,100,572 Number of Sequences: 219361 Number of extensions: 1297597 Number of successful extensions: 3051 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2998 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3049 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)